SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30114.Seq
         (672 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0)                101   7e-22
SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.)              84   9e-17
SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0)                 75   4e-14
SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06)           64   1e-10
SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0)                 64   1e-10
SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0)                 61   7e-10
SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27)           61   7e-10
SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33)            59   3e-09
SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41)       56   3e-08
SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21)           42   6e-04
SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.)                41   8e-04
SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0)                     38   0.010
SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)           36   0.022
SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19)           34   0.091
SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19)                 34   0.091
SB_31331| Best HMM Match : Thioredoxin (HMM E-Value=1.2)               34   0.12 
SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07)           33   0.21 
SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.48 
SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058)                   29   2.6  
SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.6  
SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05)            29   2.6  
SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.6  
SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.4  
SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.5  
SB_8819| Best HMM Match : I-set (HMM E-Value=0)                        29   4.5  
SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.0  
SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1)               28   7.9  
SB_25578| Best HMM Match : ShTK (HMM E-Value=2.4e-06)                  28   7.9  
SB_40719| Best HMM Match : CUB (HMM E-Value=1.2e-07)                   28   7.9  
SB_15718| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.9  

>SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 536

 Score =  101 bits (241), Expect = 7e-22
 Identities = 45/84 (53%), Positives = 62/84 (73%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +LAKVDAT E  L E + V+GYPT+KFF++G P +Y+GGR A +I+SWL KKTGPPA ++
Sbjct: 78  KLAKVDATAETKLGEKFQVQGYPTIKFFKDGKPSEYAGGRTAPEIVSWLNKKTGPPAKDL 137

Query: 433 TSAEQAKELIDANTVIVFGFFSDQ 504
            +A+  K+ I    V V GFF+D+
Sbjct: 138 ATADAMKDFI-TKEVAVVGFFTDK 160



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 42/82 (51%), Positives = 60/82 (73%)
 Frame = +2

Query: 23  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 202
           M++L    +AL+ LA  +E+  EE+VLVL++ NF+  +   +++LVEFYAPWCGHCK+LA
Sbjct: 1   MKLLPVLLLALVSLAYSEEIKEEEDVLVLTEKNFDEAVAANKHVLVEFYAPWCGHCKALA 60

Query: 203 PEYAKAATKLAEEESPIN*RKL 268
           PEYAKAA +L  E+S I   K+
Sbjct: 61  PEYAKAAGQLKSEKSEIKLAKV 82



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +2

Query: 8   ADNIEMRVLIFTAIALLGLALGDEVPTE---ENVLVLSKANFETVITTTEY-ILVEFYAP 175
           ++N++  V  F    L    L  E+P +   + V VL   NF+ V    +  + VEFYAP
Sbjct: 353 SENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAP 412

Query: 176 WCGHCKSLAPEYAKAATK 229
           WCGHCK LAP + +   K
Sbjct: 413 WCGHCKQLAPIWDQLGEK 430



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF-RNGSPIDYSGGRQADDIISWLK---KKTGPPA 423
           +AK+D+T  +   E   V  +PT+K+F + G  +DY+GGR  DD + +L+   K    PA
Sbjct: 439 VAKMDSTANE--VEGVKVHSFPTIKYFPKEGEAVDYNGGRTLDDFVKFLESGGKAGNEPA 496

Query: 424 VE 429
            E
Sbjct: 497 AE 498



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +3

Query: 483 IWFLFGPELARAKTFLSTAQVVDDQVFAIVSDEKVIQ 593
           + F    E   AK FLS A  +DD  F IVSD+ + Q
Sbjct: 154 VGFFTDKESDAAKAFLSAADGIDDVEFGIVSDKLLPQ 190


>SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 645

 Score = 84.2 bits (199), Expect = 9e-17
 Identities = 37/60 (61%), Positives = 44/60 (73%)
 Frame = +2

Query: 74  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           DEV  E++V VL+  NF+ VI     ILVEFYAPWCGHCKSLAPEYAKAA K+   + P+
Sbjct: 55  DEVKEEDDVSVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPV 114



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 30/57 (52%), Positives = 37/57 (64%)
 Frame = +2

Query: 83  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           P     L L+K NF  V+     +LVEF+APWCGHCK LAPEY KAA +L + + PI
Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKHDPPI 229



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 32/84 (38%), Positives = 51/84 (60%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           LA VDAT E +LA+ Y V+GYPTLK FR G   +Y G R    I S+++ + GP +  ++
Sbjct: 231 LAIVDATIESELAQKYEVQGYPTLKVFRKGKATEYKGQRDQYGIASYMRSQVGPSSRILS 290

Query: 436 SAEQAKELI-DANTVIVFGFFSDQ 504
           S +  ++ + + + V + GFF  +
Sbjct: 291 SLKAVQDFMKEKDDVTIMGFFDGE 314



 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 31/86 (36%), Positives = 53/86 (61%), Gaps = 6/86 (6%)
 Frame = +1

Query: 259 AKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG-----PPA 423
           AK+DAT   D+A+ + V GYPTLK FR G+P +Y G R+   I+ ++KK++      PP 
Sbjct: 117 AKMDATVASDIAQRFDVSGYPTLKIFRKGTPYEYEGPREESGIVEYMKKQSDPNWKPPPV 176

Query: 424 VEVT-SAEQAKELIDANTVIVFGFFS 498
             +T + E   E+++  ++++  FF+
Sbjct: 177 AALTLTKENFTEVVNRESLMLVEFFA 202



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPPAV 426
           +AK+DAT   D+  +Y V G+PT+ F  +    +PI + GGR+  D+I ++++K    A 
Sbjct: 578 IAKIDATAN-DVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEK----AT 632

Query: 427 EVTSAEQAKE 456
              S E+AK+
Sbjct: 633 VSLSKEKAKD 642



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +2

Query: 11  DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANFETVITTTEY-ILVEFYAPWC 181
           D++   V  F A  L  +     VP   +E V V+    F+ ++   +  +L+EFYAPWC
Sbjct: 496 DSLREFVEEFKAGNLKPIIKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWC 555

Query: 182 GHCKSLAPEYAK 217
           G   +L P + K
Sbjct: 556 G--IALEPTFKK 565


>SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 1056

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 40/82 (48%), Positives = 52/82 (63%), Gaps = 3/82 (3%)
 Frame = +1

Query: 256 LAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAVE 429
           LAKVD T+  +D    YGV GYPTLK FRNG    DY G R +  II ++KK+ GP +VE
Sbjct: 593 LAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGPSSVE 652

Query: 430 VTSAEQ-AKELIDANTVIVFGF 492
           + S +   K+L DA + +V GF
Sbjct: 653 IKSVDHLEKKLDDAESNVVVGF 674



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +2

Query: 95  NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           +VL L  +NF++ +   + +LVEF+APWCGHCK LAPEY  AA  L + + P+
Sbjct: 539 DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPV 591



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query: 98   VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLTQ 274
            V V+   NF+ ++   T+ +L+EFYAPWCGHCKSL P+Y +   KL ++   I   K+  
Sbjct: 864  VKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKL-QDVKDIVIAKMDA 922

Query: 275  LKNRISPRATVYEDTRLSNSSGMXVLSTIQVVV 373
              N   P  +V +   + +  G+ ++  I +++
Sbjct: 923  TANDAPPNFSV-QGIIIISIIGIIIIVIIMIII 954



 Score = 31.9 bits (69), Expect = 0.48
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +1

Query: 301 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 414
           +G+  +PTLK FR G P  DY+G +    + S++  + G
Sbjct: 448 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 486


>SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06)
          Length = 70

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +2

Query: 95  NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           +VL L  +NF++ +   + +LVEF+APWCGHCK LAPEY  AA  L + + P+
Sbjct: 14  DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPV 66


>SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 362

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 28/49 (57%), Positives = 39/49 (79%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  EENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           +E+V+ L+  NFE  V+ + +  LVEF+APWCGHC+ LAPE+AKAAT+L
Sbjct: 78  KEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATEL 126



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 31/90 (34%), Positives = 42/90 (46%), Gaps = 10/90 (11%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKKKTG- 414
           ++  +DAT     A  Y V+GYPT+K F  G     S  DY GGR A DII +   K   
Sbjct: 131 KVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYALDKAAD 190

Query: 415 ----PPAVEVTSAEQAKELIDANTVIVFGF 492
               P  ++  S E  KE  + + + V  F
Sbjct: 191 SIEPPEVIQAISNEVLKEGCNEHPICVIAF 220



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = +1

Query: 283 QDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 390
           Q +   Y +RG+PT+K F     SP DY+G R A  I+
Sbjct: 5   QSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIV 42


>SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 295

 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 211
           T+  V+ L+K NF+ V+   ++ LVEFYAPWCGHCK LAP Y
Sbjct: 20  TQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTY 61



 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 25/55 (45%), Positives = 40/55 (72%), Gaps = 2/55 (3%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 414
           +AKVDA  ++DL   + V+G+PT+K+F  GS  P +Y+GGR  +D I ++++KTG
Sbjct: 76  IAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTG 130


>SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27)
          Length = 472

 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%)
 Frame = +2

Query: 62  LALGDEVPTEENVLV-LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           L   D VP +E  L+ L  +NFE  +   +++LV+FYAPWC HCK +AP+Y   A +L
Sbjct: 123 LMASDGVPDDEPTLLELDDSNFEPAVQKHKFVLVDFYAPWCFHCKKMAPDYKDVAKEL 180



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 24/62 (38%), Positives = 34/62 (54%)
 Frame = +2

Query: 83  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*R 262
           P    VL L+  NF   I   EY+LV+FYAPWC  C+ L+P +  AA +L +    +   
Sbjct: 48  PASPAVLNLNDQNFNETIKKNEYVLVDFYAPWCSDCQRLSPLFDTAALQLRDNNPSLRFA 107

Query: 263 KL 268
           K+
Sbjct: 108 KV 109


>SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33)
          Length = 386

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 3/62 (4%)
 Frame = +2

Query: 74  DEVP---TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           DE P   T   V+ L    F+  +     +LV FYAPWCGHCK++ PEY  AA  L E+E
Sbjct: 73  DEKPWSDTPSEVVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQE 132

Query: 245 SP 250
            P
Sbjct: 133 IP 134



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +2

Query: 77  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           E+P+E  V  LS   F++ +   +++LV FYAPWCGHCK   PE   AA
Sbjct: 192 EIPSE--VYHLSDTTFKSFVKKKKHVLVMFYAPWCGHCKKAKPELMSAA 238



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +1

Query: 238 RRISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL-KKKTG 414
           R I+Y  A VD T+E  + + +GV GY    F    +   Y+ GR+A D I ++   + G
Sbjct: 266 RLIAY--AAVDCTKEMAVCQQFGVEGY----FNYGKNDFKYTSGREAKDFIQFMDDPREG 319

Query: 415 PP 420
           PP
Sbjct: 320 PP 321



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           +++  Y   CG+CK   PE+A AAT+  +E
Sbjct: 2   VVIVLYIAGCGYCKRFKPEFAAAATEHKDE 31



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPT 324
           LA VDAT+E  L + + V GYPT
Sbjct: 137 LAAVDATKEAALGKRFKVEGYPT 159


>SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41)
          Length = 271

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 2/57 (3%)
 Frame = +2

Query: 89  EENVLV--LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 253
           E++ LV  L  ++F   +  TE++LV FYAPWCGHCK+  P+Y KAA    ++ + +
Sbjct: 144 EDSSLVKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKDQPNRV 200



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 23/66 (34%), Positives = 36/66 (54%)
 Frame = +2

Query: 59  GLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           G    D    +  V+ L+  + +  I + E +LV ++APWCGHC  + P Y KAA  L +
Sbjct: 39  GYPTSDWSKDDSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHD 98

Query: 239 EESPIN 256
           E++  N
Sbjct: 99  EDANCN 104



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 259 AKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGP 417
           AK+D T+  D+ +   V GYPTL+++  G   ++Y G R  +D+IS++++   P
Sbjct: 202 AKLDCTKFGDVCDKEEVNGYPTLRYYLYGKFVVEYDGDRVTEDLISFMEEPPLP 255



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 13/48 (27%), Positives = 26/48 (54%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL 399
           LA VD T+ +D+A+   + GYPT+K ++  +    +   +   ++  L
Sbjct: 105 LAAVDCTKHKDVAKKVALAGYPTVKLYKASNTAKAASAEEDSSLVKQL 152


>SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 488

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 22/51 (43%), Positives = 32/51 (62%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           E  +  L+  +F+  +   E +LV+FYAPWC  C +L P+Y KAA  LA+E
Sbjct: 21  ENPIFELTDQDFDNFLKDKEVMLVDFYAPWCSDCDNLRPKYEKAARDLAKE 71


>SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 564

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +2

Query: 107 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 235
           L+  NF+ +I   + +LV+FYAPWC HC+ L P+   AA  LA
Sbjct: 25  LNAQNFDQMIREKDIMLVDFYAPWCHHCQELLPQLEGAANALA 67


>SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 711

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = +2

Query: 104 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           V SK  F  V+ + +  +V+FYAPWCG C   AP+Y + A  L
Sbjct: 438 VNSKNFFTDVLASEDAWVVDFYAPWCGPCMRFAPKYEQLAKML 480



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +2

Query: 62  LALGDEVPTEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAA 223
           +AL  +     NV  L   +F + +T+ +    V+F+APWC  C  L PEY KAA
Sbjct: 274 IALFAKESVSSNVHALGPEDFPSSVTSPSRPFFVDFFAPWCPPCMRLLPEYRKAA 328



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 16/46 (34%), Positives = 22/46 (47%)
 Frame = +1

Query: 265 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 402
           VD T    L   Y +R YPT   + N  P  + G   A DII +++
Sbjct: 341 VDCTVHSQLCHQYNIRSYPTTILYNNSQPHQFIGHHNALDIIEFVE 386


>SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21)
          Length = 186

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 405
           +AKVD T + +L     +R YPT+K + +G    Y+G R A+D+  ++ K
Sbjct: 21  IAKVDCTSDVNLCVKQNIRAYPTMKLYYDGDIKRYTGRRNAEDMKVFVDK 70



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           +E  V +L+K  F+  I    +  V+FYAPWC HC  LAP + + A
Sbjct: 88  SEAGVHILTKNTFDKHIELGLHF-VKFYAPWCIHCIKLAPIWERLA 132



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 307 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 399
           + GYPTL  F++G    +YSG R  D +  ++
Sbjct: 146 INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 177


>SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 94

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 2/39 (5%)
 Frame = +2

Query: 113 KANFETVITTTE--YILVEFYAPWCGHCKSLAPEYAKAA 223
           +A F +VI  T+   ++++FYA WCG C+ + P++ K A
Sbjct: 18  RAEFNSVINNTKDKLVVIDFYAEWCGPCRQIKPKFKKMA 56


>SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0)
          Length = 308

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +2

Query: 95  NVLVLS-KANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAATK 229
           NV VL   + F   +T   T+ ++ +F A WCG CKS+AP Y+  + K
Sbjct: 8   NVKVLELDSQFTAELTNAGTKLVVADFTASWCGPCKSIAPVYSGLSEK 55



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 414
           K+D    Q+LA   GV   PT +FF+N   +D   G     +   +KK  G
Sbjct: 63  KIDVDVCQELAAKQGVTAMPTFQFFKNKVKVDEVRGADPKALEDAIKKWIG 113


>SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)
          Length = 456

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +2

Query: 95  NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           NV+V+   +F +V      +  ++++F A WCG CKS+AP +   + K  +
Sbjct: 9   NVIVVEDDSFFSVEIERAGSRLVVIDFTATWCGPCKSIAPVFTNLSMKFMD 59



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 357
           KVD  Q Q  AES G+R  PT  F+ N + ID
Sbjct: 64  KVDVDQCQLTAESCGIRAMPTFHFYHNKAKID 95


>SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19)
          Length = 975

 Score = 34.3 bits (75), Expect = 0.091
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAP 205
           + VI   + +L+ FY PWCG C + AP
Sbjct: 529 DIVINNDQDVLLVFYTPWCGMCINFAP 555


>SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19)
          Length = 335

 Score = 34.3 bits (75), Expect = 0.091
 Identities = 10/51 (19%), Positives = 28/51 (54%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 244
           + ++  +  N +  +  ++++ + FYAPW  HC+ +   + + A + A+ +
Sbjct: 26  KKIVEFTNENVDEYVDGSKFVFIFFYAPWDDHCQRILQIFDQVADEFADRD 76


>SB_31331| Best HMM Match : Thioredoxin (HMM E-Value=1.2)
          Length = 214

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 20/80 (25%), Positives = 37/80 (46%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 435
           +A V+  +E +LA+  GV+    +  F  G  ++Y  G   +   + + +   PP   + 
Sbjct: 106 VAAVNVAEEYELAQKLGVKFSGAISVFHRGKRVEYY-GHSCNLTNNVVFQMFDPPVTNID 164

Query: 436 SAEQAKELIDANTVIVFGFF 495
           + +Q   L DA    V G+F
Sbjct: 165 NKKQRTLLEDAEGTKVVGYF 184


>SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07)
          Length = 438

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 5/60 (8%)
 Frame = +2

Query: 122 FETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA-----TKLAEEESPIN*RKLTQLKNR 286
           F+  +   E   ++F A WCG C+ + P++ + A      K A+ +  +N  ++ ++ NR
Sbjct: 4   FDKFLKDNEVAAIDFTATWCGPCRMIGPKFEEMAKEFKGVKCAKVDVDVNSVEVLRVDNR 63


>SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 335

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +1

Query: 301 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 414
           +G+  +PTLK FR G P  DY+G +    + S++  + G
Sbjct: 251 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 289


>SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058)
          Length = 664

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +2

Query: 158 VEFYAPWCGHCKSLAPEYAKAATKL 232
           V FYAPWCG  +    E+  AA+ L
Sbjct: 457 VFFYAPWCGQSRRAVEEFNIAASLL 481


>SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 39

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 95  NVLVLSKANFETVITTTEYILVEFYA 172
           NV++L + NF+ VI   + + V FYA
Sbjct: 12  NVVILDEGNFDKVIAENKLVFVNFYA 37


>SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05)
          Length = 215

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +2

Query: 119 NFETVITTTEYIL--VEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLTQLKNRI 289
           +F+ +++++  +L  V F+APW  HC  +         +LA+E   +N  K  ++ +RI
Sbjct: 11  DFDRILSSSSNVLAVVHFFAPWAPHCNQM----NDVLEELAKENPHVNFIKNQKVVDRI 65


>SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 41

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 307 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 399
           + GYPTL  F++G    +YSG R  D +  ++
Sbjct: 1   INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 32


>SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2337

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 3/59 (5%)
 Frame = +3

Query: 198  WHRNT-PRQQQSW--LKKNLLSTSES*RNSRTGSRRELRCTRIPDSQILQEWXSYRLFR 365
            WHR T P     W  L KN+  T +    SR G+R+ L+   +    IL ++    LF+
Sbjct: 1471 WHRLTIPSTMNDWPQLSKNVQLTVDDFNASRYGTRQALQQNYLDLQMILDKYNEKVLFK 1529


>SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1198

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 189 ANLWHRNTPRQQQSWLKKNLLSTSES*RNSRTGSR 293
           +N  H++TPR ++ W K+   S +E   ++R  SR
Sbjct: 91  SNAKHKDTPRPKEDWYKETQSSLAEELDDTRQRSR 125


>SB_8819| Best HMM Match : I-set (HMM E-Value=0)
          Length = 1789

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 2/39 (5%)
 Frame = +1

Query: 244  ISYQLAKVDATQEQDLAESYGVRGYP--TLKFFRNGSPI 354
            +S +L  V  T+E D   +  V G P  T+K+F++G P+
Sbjct: 1039 LSSKLQPVQVTEEDDCKLTCKVSGLPEPTIKWFKDGEPV 1077


>SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1281

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = -1

Query: 336 EEFESRVSSYTVALGEILFLSCVNFR*LIGDSSSASFVAA 217
           +E  +R +S     GEIL  S  N   ++G  SS SFVAA
Sbjct: 859 DEGRTRSNSTFTTAGEILTSSKANSGKVMGSKSSCSFVAA 898


>SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1)
          Length = 213

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 8/15 (53%), Positives = 13/15 (86%)
 Frame = +2

Query: 176 WCGHCKSLAPEYAKA 220
           WCG CK+L P++A++
Sbjct: 8   WCGACKALRPKFAES 22


>SB_25578| Best HMM Match : ShTK (HMM E-Value=2.4e-06)
          Length = 257

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 146 EYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +YI+ +F    CG CK+LAP   ++ T
Sbjct: 123 KYIMKKFCQKECGLCKALAPPICQSTT 149


>SB_40719| Best HMM Match : CUB (HMM E-Value=1.2e-07)
          Length = 272

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/61 (27%), Positives = 29/61 (47%)
 Frame = +1

Query: 337 RNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQS*PE 516
           R+ +P+  +G    DDI + L  +  PP       E A E+  A+  +V G  + ++  E
Sbjct: 173 RDLTPLPGNGVPTLDDIPAVLIAEDRPPTYSEAVEEDALEMTAADVAVVHGGHTGETDTE 232

Query: 517 P 519
           P
Sbjct: 233 P 233


>SB_15718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 712

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 14/47 (29%), Positives = 20/47 (42%)
 Frame = -3

Query: 244 FFFSQLCCCLGVFRCQRFAVAAPWSIEFN*NVLRGCNYSFKVSFTQN 104
           F F  LC   G        +   W+ E + N + GC+Y   VS  Q+
Sbjct: 147 FEFIDLCSGFGFVVLPTVVICTSWNQESHMNNITGCSYQKPVSTNQS 193


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,826,804
Number of Sequences: 59808
Number of extensions: 352501
Number of successful extensions: 888
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 782
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 883
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1721264831
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -