SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.0  
SB_53659| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  

>SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2653

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +2

Query: 431 LLKLLKHRHRQPVSLHCWM*TSPIVRTMH--DPLPFASN 541
           ++  + H+H Q  S+HC + T+  +R  H  +P  F SN
Sbjct: 765 IMSEMAHKHFQQASIHCLLYTNFQIRPKHNMEPEKFESN 803


>SB_53659| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 189

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 11/50 (22%)
 Frame = -2

Query: 581 NKWADDLWQYAGK------NWM-----RKVEDRALCGLWERFTSSSGEIQ 465
           ++WADDLW  A K       WM     RK E+R+  G   R T S  ++Q
Sbjct: 133 DRWADDLWTDAQKVGGKVNRWMDSQTDRKWEERSTDGWTVRRTESGRKVQ 182


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,487,448
Number of Sequences: 59808
Number of extensions: 358467
Number of successful extensions: 842
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 782
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 840
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1434459094
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -