SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_5808| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.28 
SB_49663| Best HMM Match : TolA (HMM E-Value=0.059)                    31   0.66 
SB_16738| Best HMM Match : DUF217 (HMM E-Value=7.8)                    31   0.87 
SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0)               30   2.0  
SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_3663| Best HMM Match : MBT (HMM E-Value=0)                          29   2.7  
SB_23704| Best HMM Match : Utp14 (HMM E-Value=2.1e-10)                 29   3.5  
SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.)                29   3.5  
SB_17517| Best HMM Match : CRAL_TRIO_N (HMM E-Value=0.072)             29   4.6  
SB_39783| Best HMM Match : IQ (HMM E-Value=1e-15)                      28   6.1  
SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.1  
SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4)                      28   8.1  
SB_5169| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.1  

>SB_5808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 473

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 15/51 (29%), Positives = 25/51 (49%)
 Frame = +2

Query: 203 AGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVEN 355
           A    +KE ++ RK+ + KP+P+  K    PTRK +K  + +        N
Sbjct: 293 ATSNEKKEQEKERKKSEGKPKPRSEK-EKQPTRKRVKRPEKLNKRPGAYSN 342


>SB_49663| Best HMM Match : TolA (HMM E-Value=0.059)
          Length = 591

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +2

Query: 200 RAGEGAQKEDQRSRKRE-QSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRDL 376
           R  E A+KE++  RKRE + K   +  + +    RK  +E + ++    K E +RR ++ 
Sbjct: 380 RQREEARKEEEEKRKREGEVKKRKEEEERLVEARRKEQEEKRKLEEQKRKEEEDRRRKEA 439

Query: 377 HARSIVMLSVRLR 415
             + I     RL+
Sbjct: 440 EEKRIKEEEARLK 452


>SB_16738| Best HMM Match : DUF217 (HMM E-Value=7.8)
          Length = 261

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 437 RTVPQKXGRSSAGHRDASLAIVGLLQRAP 523
           RT P+K  R +A HRD  LAI  L++++P
Sbjct: 151 RTSPRKALRYNAPHRDKPLAITHLIEKSP 179


>SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0)
          Length = 1182

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = +2

Query: 227  DQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVR 370
            D+    ++++ P  +PAKGVT  +R G  ++       SK +  + V+
Sbjct: 1134 DEAQPGKKKAAPRKRPAKGVTAASRDGDSDSDASVEVVSKKKTTKAVK 1181


>SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 394

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +3

Query: 123 YGVGVVNRYALFLDDETDPLDALK 194
           Y +GV NR+ L L DE DP    K
Sbjct: 6   YSIGVNNRFGLLLSDEEDPETTFK 29


>SB_3663| Best HMM Match : MBT (HMM E-Value=0)
          Length = 327

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 10/35 (28%), Positives = 21/35 (60%)
 Frame = +2

Query: 194 SARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPT 298
           SA + +  ++E++   K ++ KP+P+P     +PT
Sbjct: 158 SAASSDDEEEEEEEEEKEKEEKPKPEPELAPPLPT 192


>SB_23704| Best HMM Match : Utp14 (HMM E-Value=2.1e-10)
          Length = 574

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +2

Query: 203 AGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRR 364
           + EG +K+D    + + +KPEP+  KG    T++G K+T    +  S+  N +R
Sbjct: 344 SSEG-EKDDDDDFELQLAKPEPEGKKG----TKRGKKKTSKDATEESEAPNKKR 392


>SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 730

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +2

Query: 218 QKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQN 325
           +K D+ +R + Q KP  KP+      T+   K+TQN
Sbjct: 548 KKSDKLARSKRQQKPVNKPSTEAGTKTQGTAKKTQN 583


>SB_17517| Best HMM Match : CRAL_TRIO_N (HMM E-Value=0.072)
          Length = 2374

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 13/50 (26%), Positives = 25/50 (50%)
 Frame = +2

Query: 215 AQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRR 364
           A    Q+S+K+E++K   + +KG     R G+K  +        ++N +R
Sbjct: 24  APTNPQKSKKKEKAKEADEGSKGKKKNKRWGLKRKKKADEGNKGIKNKKR 73


>SB_39783| Best HMM Match : IQ (HMM E-Value=1e-15)
          Length = 371

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = +2

Query: 200 RAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKE--TQNVKSXTSKVENNRRVRD 373
           RA    Q++ +R RK ++ KP      G+T   R  ++E   Q  +    K      +++
Sbjct: 194 RAAIRIQRQFRRYRKGKEDKPPHPFLSGLTDARRVELQEIIVQRRERFPPKHRTPVELKE 253

Query: 374 LHARSIVMLSVRLRVVVKIGR 436
           LH ++  +LS  + V +K  R
Sbjct: 254 LHEKAHSLLSSHVMVAMKARR 274


>SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1480

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = -1

Query: 618 KRGPRGPSRRLTRWSWWTANALHR 547
           K  P G +RR+ RW W   +  HR
Sbjct: 292 KSVPLGSTRRIRRWEWQYCDVCHR 315


>SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4)
          Length = 330

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = +2

Query: 230 QRSRKREQSKPEPKPAKGVTVPTRKG 307
           QR + RE +KPE KP+ G      KG
Sbjct: 47  QREKPRESTKPEEKPSGGNHTSQEKG 72


>SB_5169| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 345

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +2

Query: 317 TQNVKSXTSKVENNRRVRDLHARSIVMLSVR 409
           T+ +K   S + N +++ D H +SI+ LS+R
Sbjct: 162 TETIKISYSCMSNTKQIIDSHNKSIIALSIR 192


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,277,845
Number of Sequences: 59808
Number of extensions: 301466
Number of successful extensions: 2912
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 2816
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2908
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1769412099
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -