SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08)             73   1e-13
SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   4e-10
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              60   2e-09
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       60   2e-09
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          60   2e-09
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)                  57   9e-09
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)                57   9e-09
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   9e-09
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           57   9e-09
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   9e-09
SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)                    53   2e-07
SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   6e-07
SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)                   50   1e-06
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     50   1e-06
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   1e-06
SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   1e-06
SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   2e-06
SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)               46   2e-05
SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)              46   2e-05
SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5)                    46   3e-05
SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   3e-04
SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.005
SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.011
SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.011
SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.011
SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.)               37   0.011
SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.025
SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.033
SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)             35   0.057
SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)                     35   0.057
SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)           35   0.057
SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)                  35   0.057
SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 35   0.057
SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)                  35   0.057
SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)                     35   0.057
SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)                35   0.057
SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.057
SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)             35   0.057
SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)                    35   0.057
SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)                35   0.057
SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)        35   0.057
SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)                    35   0.057
SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.057
SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)                        35   0.057
SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.075
SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.13 
SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.17 
SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.23 
SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.23 
SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066)                  33   0.23 
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                     32   0.30 
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               32   0.30 
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)                  32   0.30 
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                    32   0.30 
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)           32   0.30 
SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     32   0.30 
SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)             32   0.30 
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)          32   0.30 
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)                   32   0.30 
SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                        32   0.30 
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)           32   0.30 
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                   32   0.30 
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                    32   0.30 
SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    32   0.30 
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                    32   0.30 
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)                       32   0.30 
SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)               32   0.30 
SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)                      32   0.30 
SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)                32   0.30 
SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)                      32   0.30 
SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)               32   0.30 
SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016)                32   0.30 
SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6)                    32   0.30 
SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)                    32   0.30 
SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46412| Best HMM Match : HEAT (HMM E-Value=8)                        32   0.30 
SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)                     32   0.30 
SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)                    32   0.30 
SB_46308| Best HMM Match : IMS (HMM E-Value=0)                         32   0.30 
SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)               32   0.30 
SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)                 32   0.30 
SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)                      32   0.30 
SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)                 32   0.30 
SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003)               32   0.30 
SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2)                    32   0.30 
SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)        32   0.30 
SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)                   32   0.30 
SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)                    32   0.30 
SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)                32   0.30 
SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016)                 32   0.30 
SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21)                32   0.30 
SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)                 32   0.30 
SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36)               32   0.30 
SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2)             32   0.30 
SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)               32   0.30 
SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2)             32   0.30 
SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78)              32   0.30 
SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)             32   0.30 
SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34793| Best HMM Match : TIL (HMM E-Value=4.5)                       32   0.30 
SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3)             32   0.30 
SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                         32   0.30 
SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15)                 32   0.30 
SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0)                 32   0.30 
SB_32525| Best HMM Match : DED (HMM E-Value=0.81)                      32   0.30 
SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28)              32   0.30 
SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6)                    32   0.30 
SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31658| Best HMM Match : Arm (HMM E-Value=0.91)                      32   0.30 
SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31)              32   0.30 
SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076)                    32   0.30 
SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13)                     32   0.30 
SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4)              32   0.30 
SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021)                   32   0.30 
SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05)                     32   0.30 
SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038)                     32   0.30 
SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 
SB_29332| Best HMM Match : PAN (HMM E-Value=0.039)                     32   0.30 
SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.30 

>SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08)
          Length = 120

 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 37/44 (84%), Positives = 39/44 (88%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXH 332
           MVR+NVL+DAL SI NAEKRGKRQV IRP SKVIVKFLTVMM H
Sbjct: 1   MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKH 44


>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 24/25 (96%), Positives = 24/25 (96%)
 Frame = -1

Query: 594 QGFPSHDVVKRRPVNCNTTHYRXNW 520
           QGFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 78  QGFPSHDVVKRRPVNCNTTHYRANW 102


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 23/25 (92%), Positives = 24/25 (96%)
 Frame = -1

Query: 594 QGFPSHDVVKRRPVNCNTTHYRXNW 520
           +GFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 35  KGFPSHDVVKRRPVNCNTTHYRANW 59


>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 408

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -1

Query: 591 GFPSHDVVKRRPVNCNTTHYRXNW 520
           GFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 1   GFPSHDVVKRRPVNCNTTHYRANW 24


>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -1

Query: 591 GFPSHDVVKRRPVNCNTTHYRXNW 520
           GFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 57  GFPSHDVVKRRPVNCNTTHYRANW 80


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -1

Query: 591 GFPSHDVVKRRPVNCNTTHYRXNW 520
           GFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -1

Query: 591 GFPSHDVVKRRPVNCNTTHYRXNW 520
           GFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 57  GFPSHDVVKRRPVNCNTTHYRANW 80


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -1

Query: 591 GFPSHDVVKRRPVNCNTTHYRXNW 520
           GFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 68  GFPSHDVVKRRPVNCNTTHYRANW 91


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -1

Query: 591 GFPSHDVVKRRPVNCNTTHYRXNW 520
           GFPSHDVVKRRPVNCNTTHYR NW
Sbjct: 68  GFPSHDVVKRRPVNCNTTHYRANW 91


>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
          Length = 117

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -1

Query: 588 FPSHDVVKRRPVNCNTTHYRXNW 520
           FPSHDVVKRRPVNCNTTHYR NW
Sbjct: 39  FPSHDVVKRRPVNCNTTHYRANW 61


>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -1

Query: 588  FPSHDVVKRRPVNCNTTHYRXNW 520
            FPSHDVVKRRPVNCNTTHYR NW
Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899


>SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -1

Query: 588 FPSHDVVKRRPVNCNTTHYRXNW 520
           FPSHDVVKRRPVNCNTTHYR NW
Sbjct: 37  FPSHDVVKRRPVNCNTTHYRANW 59


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -1

Query: 588 FPSHDVVKRRPVNCNTTHYRXNW 520
           FPSHDVVKRRPVNCNTTHYR NW
Sbjct: 31  FPSHDVVKRRPVNCNTTHYRANW 53


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -1

Query: 588 FPSHDVVKRRPVNCNTTHYRXNW 520
           FPSHDVVKRRPVNCNTTHYR NW
Sbjct: 45  FPSHDVVKRRPVNCNTTHYRANW 67


>SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)
          Length = 142

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 22/25 (88%), Positives = 23/25 (92%)
 Frame = +1

Query: 520 PIRPIVSRITIHWPSFYNVVTGKTL 594
           PIRPIVSRITIHWP+FYN  TGKTL
Sbjct: 39  PIRPIVSRITIHWPAFYNAPTGKTL 63


>SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +1

Query: 523 IRPIVSRITIHWPSFYNVVTGKTL 594
           +RP+VSRITIHW SFYNVVTGKTL
Sbjct: 33  LRPVVSRITIHWTSFYNVVTGKTL 56


>SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)
          Length = 257

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = -1

Query: 579 HDVVKRRPVNCNTTHYRXNW 520
           HDVVKRRPVNCNTTHYR NW
Sbjct: 2   HDVVKRRPVNCNTTHYRANW 21


>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 237

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = -1

Query: 594 QGFPSHDVVKRRPVNCNTTHYRXN 523
           +GFPSHD  KRRPVNCNTTHYR N
Sbjct: 74  RGFPSHDGEKRRPVNCNTTHYRAN 97


>SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = -1

Query: 579 HDVVKRRPVNCNTTHYRXNW 520
           HDVVKRRPVNCNTTHYR NW
Sbjct: 2   HDVVKRRPVNCNTTHYRANW 21


>SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 29

 Score = 50.0 bits (114), Expect = 1e-06
 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%)
 Frame = -2

Query: 251 CGVISPRFDVPINDIERW-TNLLPSRQF 171
           CGVISPRFDV + DIE+W +NLLPSRQF
Sbjct: 1   CGVISPRFDVGVRDIEQWASNLLPSRQF 28


>SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 20/22 (90%), Positives = 20/22 (90%)
 Frame = -1

Query: 588 FPSHDVVKRRPVNCNTTHYRXN 523
           F SHDVVKRRPVNCNTTHYR N
Sbjct: 19  FRSHDVVKRRPVNCNTTHYRAN 40


>SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 20/22 (90%), Positives = 21/22 (95%)
 Frame = +1

Query: 529 PIVSRITIHWPSFYNVVTGKTL 594
           P +SRITIHWPSFYNVVTGKTL
Sbjct: 77  PYMSRITIHWPSFYNVVTGKTL 98


>SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKTL 594
           SRITIHWPSFYNVVTGKTL
Sbjct: 2   SRITIHWPSFYNVVTGKTL 20


>SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKTL 594
           SRITIHWPSFYNVVTGKTL
Sbjct: 2   SRITIHWPSFYNVVTGKTL 20


>SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKTL 594
           SRITIHWPSFYNVVTGKTL
Sbjct: 2   SRITIHWPSFYNVVTGKTL 20


>SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKTL 594
           SRITIHWPSFYNVVTGKTL
Sbjct: 2   SRITIHWPSFYNVVTGKTL 20


>SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKTL 594
           SRITIHWPSFYNVVTGKTL
Sbjct: 2   SRITIHWPSFYNVVTGKTL 20


>SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKTL 594
           SRITIHWPSFYNVVTGKTL
Sbjct: 2   SRITIHWPSFYNVVTGKTL 20


>SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)
          Length = 98

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKTL 594
           SRITIHWPSFYNVVTGKTL
Sbjct: 2   SRITIHWPSFYNVVTGKTL 20


>SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5)
          Length = 131

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 19/21 (90%), Positives = 19/21 (90%)
 Frame = +1

Query: 520 PIRPIVSRITIHWPSFYNVVT 582
           PIRPIVS ITIHWPSFYN VT
Sbjct: 41  PIRPIVSHITIHWPSFYNGVT 61


>SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGK 588
           SRITIHWPSFYNVVTGK
Sbjct: 2   SRITIHWPSFYNVVTGK 18


>SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 100

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGK 588
           SRITIHWPSFYNVVTGK
Sbjct: 2   SRITIHWPSFYNVVTGK 18


>SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGK 588
           SRITIHWPSFYNVVTGK
Sbjct: 2   SRITIHWPSFYNVVTGK 18


>SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGK 588
           SRITIHWPSFYNVVTGK
Sbjct: 2   SRITIHWPSFYNVVTGK 18


>SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = +1

Query: 523 IRPIVSRITIHWPSFY 570
           IRPIVSRITIHWPSFY
Sbjct: 18  IRPIVSRITIHWPSFY 33


>SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +1

Query: 538 SRITIHWPSFYNVVTGKT 591
           SRITIHWPSFYNV+  KT
Sbjct: 2   SRITIHWPSFYNVMLAKT 19


>SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +1

Query: 553 HWPSFYNVVTGKTL 594
           HWPSFYNVVTGKTL
Sbjct: 5   HWPSFYNVVTGKTL 18


>SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 109

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +1

Query: 553 HWPSFYNVVTGKTL 594
           HWPSFYNVVTGKTL
Sbjct: 62  HWPSFYNVVTGKTL 75


>SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +1

Query: 553 HWPSFYNVVTGKTL 594
           HWPSFYNVVTGKTL
Sbjct: 5   HWPSFYNVVTGKTL 18


>SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 104

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +1

Query: 553 HWPSFYNVVTGKTL 594
           HWPSFYNVVTGKTL
Sbjct: 57  HWPSFYNVVTGKTL 70


>SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 35.9 bits (79), Expect = 0.025
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +1

Query: 538 SRITIHWPSFYNVV 579
           SRITIHWPSFYNVV
Sbjct: 2   SRITIHWPSFYNVV 15


>SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 229

 Score = 35.5 bits (78), Expect = 0.033
 Identities = 24/59 (40%), Positives = 27/59 (45%), Gaps = 2/59 (3%)
 Frame = +3

Query: 423 IDFKASLNTFIRTMAKI*LALRSEPN*XGGPV--PXXXXXXXXXXXLAVVLQRRDWENP 593
           +DF      F R  +KI   L   PN  G  +  P           LAVVLQRRDWENP
Sbjct: 95  VDFDYRYTVFYRIQSKIYPPL--PPNIRGKKIGDPLESTCRHASLALAVVLQRRDWENP 151


>SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 43  GFSQSRRCKTTASEL 57


>SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)
          Length = 269

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 255 GFSQSRRCKTTASEL 269


>SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 937

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 923 GFSQSRRCKTTASEL 937


>SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 36  GFSQSRRCKTTASEL 50


>SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 35  GFSQSRRCKTTASEL 49


>SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)
          Length = 424

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 410 GFSQSRRCKTTASEL 424


>SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)
          Length = 273

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 259 GFSQSRRCKTTASEL 273


>SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)
          Length = 340

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 326 GFSQSRRCKTTASEL 340


>SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 406

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 392 GFSQSRRCKTTASEL 406


>SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)
          Length = 98

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 84  GFSQSRRCKTTASEL 98


>SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 372

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 43  GFSQSRRCKTTASEL 57


>SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 20/34 (58%), Positives = 22/34 (64%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL*YDSL*XELGTGPPXQFGS 491
           GFSQSRRCKTTASE   D L  E    PP ++ S
Sbjct: 43  GFSQSRRCKTTASEFPGDPLVLE---RPPPRWSS 73



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 85  LAVVLQRRDWENP 97


>SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 36  GFSQSRRCKTTASEL 50


>SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 36  GFSQSRRCKTTASEL 50


>SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 43  GFSQSRRCKTTASEL 57


>SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 43  GFSQSRRCKTTASEL 57


>SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 66  GFSQSRRCKTTASEL 80


>SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)
          Length = 316

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 302 GFSQSRRCKTTASEL 316


>SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)
          Length = 300

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 286 GFSQSRRCKTTASEL 300


>SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 36  GFSQSRRCKTTASEL 50


>SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)
          Length = 289

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 275 GFSQSRRCKTTASEL 289


>SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)
          Length = 314

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 300 GFSQSRRCKTTASEL 314


>SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 498

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 484 GFSQSRRCKTTASEL 498


>SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)
          Length = 455

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 153 GFSQSRRCKTTASEL 167


>SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)
          Length = 333

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 319 GFSQSRRCKTTASEL 333


>SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 169 GFSQSRRCKTTASEL 183


>SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 43  GFSQSRRCKTTASEL 57


>SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 362 GFSQSRRCKTTASEL 376


>SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 36  GFSQSRRCKTTASEL 50


>SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 43  GFSQSRRCKTTASEL 57


>SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 29  GFSQSRRCKTTASEL 43


>SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 242

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 228 GFSQSRRCKTTASEL 242


>SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)
          Length = 634

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 620 GFSQSRRCKTTASEL 634


>SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2021

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 256 GFSQSRRCKTTASEL 270


>SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 65  GFSQSRRCKTTASEL 79


>SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 96  GFSQSRRCKTTASEL 110


>SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 534 GFSQSRRCKTTASEL 548


>SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 36  GFSQSRRCKTTASEL 50


>SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 117 GFSQSRRCKTTASEL 131


>SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 439

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 425 GFSQSRRCKTTASEL 439


>SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 29  GFSQSRRCKTTASEL 43


>SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)
          Length = 232

 Score = 34.7 bits (76), Expect = 0.057
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASEL 548
           GFSQSRRCKTTASEL
Sbjct: 218 GFSQSRRCKTTASEL 232


>SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 13/14 (92%), Positives = 13/14 (92%)
 Frame = +1

Query: 553 HWPSFYNVVTGKTL 594
           HWPSFYN VTGKTL
Sbjct: 5   HWPSFYNDVTGKTL 18


>SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 21/56 (37%), Positives = 27/56 (48%)
 Frame = +3

Query: 426 DFKASLNTFIRTMAKI*LALRSEPN*XGGPVPXXXXXXXXXXXLAVVLQRRDWENP 593
           D++  L TF    ++  +  R   +  GG  P           LAVVLQRRDWENP
Sbjct: 7   DYEFELGTFRHECSQDAMYGRLRQSGVGGD-PLESTCRHASLALAVVLQRRDWENP 61


>SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 925

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = -3

Query: 592 GFSQSRRCKTTASE 551
           GFSQSRRCKTTASE
Sbjct: 565 GFSQSRRCKTTASE 578


>SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 201

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -1

Query: 591 GFPSHDVVKRRPV 553
           GFPSHDVVKRRPV
Sbjct: 55  GFPSHDVVKRRPV 67


>SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 18/37 (48%), Positives = 19/37 (51%)
 Frame = +3

Query: 483 LRSEPN*XGGPVPXXXXXXXXXXXLAVVLQRRDWENP 593
           L   PN  G P+            LAVVLQRRDWENP
Sbjct: 69  LNPNPNPNGDPLESTCRHASLA--LAVVLQRRDWENP 103


>SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066)
          Length = 444

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -1

Query: 591 GFPSHDVVKRRPV 553
           GFPSHDVVKRRPV
Sbjct: 217 GFPSHDVVKRRPV 229


>SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 35  LAVVLQRRDWENP 47


>SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 62  LAVVLQRRDWENP 74


>SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 44  LAVVLQRRDWENP 56


>SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 36  LAVVLQRRDWENP 48


>SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 62  LAVVLQRRDWENP 74


>SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 67  LAVVLQRRDWENP 79


>SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 38  LAVVLQRRDWENP 50


>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 58  LAVVLQRRDWENP 70


>SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 70  LAVVLQRRDWENP 82


>SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 46  LAVVLQRRDWENP 58


>SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 35  LAVVLQRRDWENP 47


>SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 25  LAVVLQRRDWENP 37


>SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 50  LAVVLQRRDWENP 62


>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 59  LAVVLQRRDWENP 71


>SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 53  LAVVLQRRDWENP 65


>SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 69  LAVVLQRRDWENP 81


>SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 57  LAVVLQRRDWENP 69


>SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 40  LAVVLQRRDWENP 52


>SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)
          Length = 297

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 216 LAVVLQRRDWENP 228


>SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 111 LAVVLQRRDWENP 123


>SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 49  LAVVLQRRDWENP 61


>SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 28  LAVVLQRRDWENP 40


>SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 16  LAVVLQRRDWENP 28


>SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 47  LAVVLQRRDWENP 59


>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
          Length = 472

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 381 LAVVLQRRDWENP 393


>SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)
          Length = 198

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 107 LAVVLQRRDWENP 119


>SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 83  LAVVLQRRDWENP 95


>SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 39  LAVVLQRRDWENP 51


>SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 8   LAVVLQRRDWENP 20


>SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 18  LAVVLQRRDWENP 30


>SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)
          Length = 129

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 38  LAVVLQRRDWENP 50


>SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 103 LAVVLQRRDWENP 115


>SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 45  LAVVLQRRDWENP 57


>SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 340 LAVVLQRRDWENP 352


>SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 80  LAVVLQRRDWENP 92


>SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 50  LAVVLQRRDWENP 62


>SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 16  LAVVLQRRDWENP 28


>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 59  LAVVLQRRDWENP 71


>SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 43  LAVVLQRRDWENP 55


>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 134 LAVVLQRRDWENP 146


>SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 63  LAVVLQRRDWENP 75


>SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 39  LAVVLQRRDWENP 51


>SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)
          Length = 295

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 143 LAVVLQRRDWENP 155


>SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 917

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 833 LAVVLQRRDWENP 845


>SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 16  LAVVLQRRDWENP 28


>SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 60  LAVVLQRRDWENP 72


>SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 34  LAVVLQRRDWENP 46


>SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 73  LAVVLQRRDWENP 85


>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 67  LAVVLQRRDWENP 79


>SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 56  LAVVLQRRDWENP 68


>SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 69  LAVVLQRRDWENP 81


>SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 256 LAVVLQRRDWENP 268


>SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)
          Length = 195

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 114 LAVVLQRRDWENP 126


>SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 50  LAVVLQRRDWENP 62


>SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 36  LAVVLQRRDWENP 48


>SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 37  LAVVLQRRDWENP 49


>SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)
          Length = 192

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 101 LAVVLQRRDWENP 113


>SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 114 LAVVLQRRDWENP 126


>SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 39  LAVVLQRRDWENP 51


>SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 20  LAVVLQRRDWENP 32


>SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 58  LAVVLQRRDWENP 70


>SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 37  LAVVLQRRDWENP 49


>SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 34  LAVVLQRRDWENP 46


>SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)
          Length = 349

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 11  LAVVLQRRDWENP 23


>SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 19  LAVVLQRRDWENP 31


>SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 487

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 396 LAVVLQRRDWENP 408


>SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 45  LAVVLQRRDWENP 57


>SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 54  LAVVLQRRDWENP 66


>SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 36  LAVVLQRRDWENP 48


>SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 119 LAVVLQRRDWENP 131


>SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 55  LAVVLQRRDWENP 67


>SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 65  LAVVLQRRDWENP 77


>SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 68  LAVVLQRRDWENP 80


>SB_54473| Best HMM Match : DLIC (HMM E-Value=0)
          Length = 1401

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 414 LAVVLQRRDWENP 426


>SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)
          Length = 174

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 111 LAVVLQRRDWENP 123


>SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)
          Length = 157

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 67  LAVVLQRRDWENP 79


>SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 56  LAVVLQRRDWENP 68


>SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)
          Length = 137

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 46  LAVVLQRRDWENP 58


>SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)
          Length = 140

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 49  LAVVLQRRDWENP 61


>SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 161 LAVVLQRRDWENP 173


>SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 65  LAVVLQRRDWENP 77


>SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 52  LAVVLQRRDWENP 64


>SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 88  LAVVLQRRDWENP 100


>SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 37  LAVVLQRRDWENP 49


>SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 63  LAVVLQRRDWENP 75


>SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 42  LAVVLQRRDWENP 54


>SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 300

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 185 LAVVLQRRDWENP 197


>SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 34  LAVVLQRRDWENP 46


>SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 40  LAVVLQRRDWENP 52


>SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 54  LAVVLQRRDWENP 66


>SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)
          Length = 142

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 51  LAVVLQRRDWENP 63


>SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 34  LAVVLQRRDWENP 46


>SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 35  LAVVLQRRDWENP 47


>SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 49  LAVVLQRRDWENP 61


>SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 39  LAVVLQRRDWENP 51


>SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 132 LAVVLQRRDWENP 144


>SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 41  LAVVLQRRDWENP 53


>SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 84  LAVVLQRRDWENP 96


>SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 22  LAVVLQRRDWENP 34


>SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)
          Length = 234

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 153 LAVVLQRRDWENP 165


>SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)
          Length = 473

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 340 LAVVLQRRDWENP 352


>SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 57  LAVVLQRRDWENP 69


>SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 21  LAVVLQRRDWENP 33


>SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)
          Length = 301

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 109 LAVVLQRRDWENP 121


>SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 86  LAVVLQRRDWENP 98


>SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 36  LAVVLQRRDWENP 48


>SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 60  LAVVLQRRDWENP 72


>SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)
          Length = 385

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 294 LAVVLQRRDWENP 306


>SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 57  LAVVLQRRDWENP 69


>SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 58  LAVVLQRRDWENP 70


>SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 16  LAVVLQRRDWENP 28


>SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 36  LAVVLQRRDWENP 48


>SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 857

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 411 LAVVLQRRDWENP 423


>SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 95  LAVVLQRRDWENP 107


>SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 51  LAVVLQRRDWENP 63


>SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 43  LAVVLQRRDWENP 55


>SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 93  LAVVLQRRDWENP 105


>SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 43  LAVVLQRRDWENP 55


>SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 211 LAVVLQRRDWENP 223


>SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 43  LAVVLQRRDWENP 55


>SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1615

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 213 LAVVLQRRDWENP 225


>SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 33  LAVVLQRRDWENP 45


>SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 48  LAVVLQRRDWENP 60


>SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 38  LAVVLQRRDWENP 50


>SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 43  LAVVLQRRDWENP 55


>SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 238

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 147 LAVVLQRRDWENP 159


>SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 45  LAVVLQRRDWENP 57


>SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 35  LAVVLQRRDWENP 47


>SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 55  LAVVLQRRDWENP 67


>SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 40  LAVVLQRRDWENP 52


>SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 75  LAVVLQRRDWENP 87


>SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)
          Length = 286

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 195 LAVVLQRRDWENP 207


>SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 53  LAVVLQRRDWENP 65


>SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 32  LAVVLQRRDWENP 44


>SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 237

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 86  LAVVLQRRDWENP 98


>SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 29  LAVVLQRRDWENP 41


>SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 22  LAVVLQRRDWENP 34


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,626,546
Number of Sequences: 59808
Number of extensions: 273236
Number of successful extensions: 3366
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 3320
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3364
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1427401750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -