SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30101.Seq
         (454 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4321| Best HMM Match : Ank (HMM E-Value=0)                          31   0.59 
SB_52413| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.0  
SB_39739| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)             30   1.0  
SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08)         29   1.8  
SB_4646| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   4.2  
SB_544| Best HMM Match : PDZ (HMM E-Value=0.15)                        27   7.3  

>SB_4321| Best HMM Match : Ank (HMM E-Value=0)
          Length = 915

 Score = 30.7 bits (66), Expect = 0.59
 Identities = 17/64 (26%), Positives = 27/64 (42%)
 Frame = +3

Query: 66  GNSEDDFCEIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVK 245
           G  E   C+ +  ++   C+ EG   T    C  + R  T +C  + +D    C G    
Sbjct: 406 GTDETRMCKDEGTDETRMCKGEGSDKT--GKCEDEGRDETRMCKGKGRDETRMCKGEGTD 463

Query: 246 ETRV 257
           ETR+
Sbjct: 464 ETRM 467


>SB_52413| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 838

 Score = 29.9 bits (64), Expect = 1.0
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = -2

Query: 129 PCGTDPLVQWNLFHRNHLHCFRKLKCTLHK 40
           P   DPL++W LF  N L C++ +   ++K
Sbjct: 458 PSKFDPLLKWELFRYNELDCWQTILKRMYK 487


>SB_39739| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)
          Length = 1120

 Score = 29.9 bits (64), Expect = 1.0
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 13/75 (17%)
 Frame = +3

Query: 42  CAMCILVYGNSEDDFCEIDSIEQEDP---CRREGGLCTVAEDCPSD----------IRAR 182
           C +C   Y  ++  FC   S+   D    C+ +G  C  A+ C +           ++ +
Sbjct: 508 CEICKCAYAPAKPGFCGSGSLSCSDAQTKCQYDGD-CAGADKCCNTQCGKICTSAVLKEK 566

Query: 183 TGLCPKQQKDGIECC 227
           TG CPK++ D +  C
Sbjct: 567 TGFCPKRRVDHVGVC 581


>SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08)
          Length = 1907

 Score = 29.1 bits (62), Expect = 1.8
 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%)
 Frame = +2

Query: 263 HGGECFSKGYCS--QSLIYEEASDCPEGXDC 349
           HG ECFS GYC+  Q L  E       G  C
Sbjct: 533 HGSECFSIGYCAYKQDLFMEATCLMSVGCQC 563


>SB_4646| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 329

 Score = 27.9 bits (59), Expect = 4.2
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +3

Query: 114 DPCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVKETRVGST 266
           D C R  G   + E CP   R    +CP+  +D +E C  V      +G+T
Sbjct: 82  DLCPR--GTRDMLEMCPRGTRDMLVMCPRFNRDMLETCPRVKDSAAYLGTT 130


>SB_544| Best HMM Match : PDZ (HMM E-Value=0.15)
          Length = 742

 Score = 27.1 bits (57), Expect = 7.3
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = -1

Query: 172 ISDGQSSATVHKPPSLRHGSSCSMESISQKSSS 74
           + + +S++    P + RH S C +E++S+KSSS
Sbjct: 431 LGEFRSTSDPDIPKTERHLSGCPIETLSRKSSS 463


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,174,096
Number of Sequences: 59808
Number of extensions: 246776
Number of successful extensions: 724
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 655
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 719
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 908427626
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -