SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)          109   2e-24
SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)             108   5e-24
SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)                97   1e-20
SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)                 65   6e-11
SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.10 
SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)              33   0.18 
SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)              33   0.31 
SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)                    32   0.41 
SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)               31   0.96 
SB_42547| Best HMM Match : AMP-binding (HMM E-Value=1.1e-05)           30   2.2  
SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)                     30   2.2  
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.1  
SB_11886| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.1  
SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.9  
SB_45203| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.9  
SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.9  

>SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)
          Length = 547

 Score =  109 bits (262), Expect = 2e-24
 Identities = 49/106 (46%), Positives = 69/106 (65%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F+T   + T++DAPGH+ F+ NMI+G +QAD  VL+++A  GEFE G  + GQTREHA+L
Sbjct: 217 FDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFERGGQTREHAML 276

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNP 577
           A T GVK L++ VNKMD     +      + + K     KK+G+NP
Sbjct: 277 AKTAGVKHLVILVNKMDDPTVKWNEERYEEIKVKLTPFLKKVGFNP 322



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/40 (42%), Positives = 28/40 (70%)
 Frame = +1

Query: 109 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           Y  G +DKRT+EK+E+EA+E  + ++  +W LD  + ER+
Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERD 205


>SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)
          Length = 123

 Score =  108 bits (259), Expect = 5e-24
 Identities = 48/78 (61%), Positives = 61/78 (78%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +F+T    +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG    GQTREHA+
Sbjct: 7   RFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQTREHAI 66

Query: 437 LAFTLGVKQLIVGVNKMD 490
           L  +LGV QLIV +NK+D
Sbjct: 67  LVRSLGVTQLIVAINKLD 84


>SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)
          Length = 106

 Score = 97.1 bits (231), Expect = 1e-20
 Identities = 44/49 (89%), Positives = 46/49 (93%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 171
           M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+
Sbjct: 1   MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEV 49


>SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)
          Length = 322

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 28/30 (93%), Positives = 29/30 (96%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQ 346
           KFET KYYVT+IDAPGHRDFIKNMITGTSQ
Sbjct: 31  KFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +1

Query: 169 MGKGSFKYAWVLDKLKAERE 228
           MGKGSFKYAWVLDKLKAERE
Sbjct: 1   MGKGSFKYAWVLDKLKAERE 20


>SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 545

 Score = 34.3 bits (75), Expect = 0.10
 Identities = 24/70 (34%), Positives = 34/70 (48%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T ID PGH  F      G +  D  VL+VAA  G      ++  ++  HA+ A      
Sbjct: 78  ITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDGV----KTQTVESIRHAMHAKV---- 129

Query: 461 QLIVGVNKMD 490
            LIV +NK+D
Sbjct: 130 PLIVAINKID 139


>SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)
          Length = 541

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 18/67 (26%), Positives = 31/67 (46%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 69  VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 122

Query: 470 VGVNKMD 490
           +  NK+D
Sbjct: 123 ILQNKID 129


>SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)
          Length = 783

 Score = 32.7 bits (71), Expect = 0.31
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +2

Query: 218 LSVXRYHNRYCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           L+  R   +    +F+     + IID PGH  F      G+S  D A+L+V
Sbjct: 659 LNAIRIQTKMVKEEFDIKIPGLLIIDTPGHESFSNLRSRGSSLCDMAILVV 709


>SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 833

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 12  MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAG 43



 Score = 28.3 bits (60), Expect = 6.7
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 99  FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 135


>SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)
          Length = 240

 Score = 31.1 bits (67), Expect = 0.96
 Identities = 24/85 (28%), Positives = 36/85 (42%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  +D PGH  F      G    D  +++VAA             QT+E    A   GV 
Sbjct: 140 IAFLDTPGHEAFTAMRARGAQVTDLVIIVVAADDDVMP-------QTKEAISHAQAAGV- 191

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSR 535
            +I  +NK+D    P  +PD  K++
Sbjct: 192 PIIFAINKIDK---PNANPDNIKTQ 213


>SB_42547| Best HMM Match : AMP-binding (HMM E-Value=1.1e-05)
          Length = 529

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -1

Query: 529 FPQIWAHVWWFSGIHFVYSYDELFDT 452
           + + W   W FSGI    +YDE+ DT
Sbjct: 54  YAEFWEMFWTFSGIIHSQTYDEVIDT 79


>SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 359

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 9/35 (25%), Positives = 19/35 (54%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           + I+D PGH+DF ++     +  D  ++++    G
Sbjct: 81  INILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIY 111
           T I + V+G+V+SGKST  G L Y
Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTY 134


>SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2670

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +1

Query: 49   NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 147
            N  ++ HVD GKST    L+   G I K +  K
Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK 1975


>SB_11886| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 12/30 (40%), Positives = 14/30 (46%)
 Frame = +1

Query: 526 EIKKEVSSYIQEDWLQPSCCRFRAHFWMAR 615
           E+  E    I E WL+  C  F A  W AR
Sbjct: 17  ELDSECRQIISEIWLRDDCVTFPAPLWRAR 46


>SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 941

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 503 PYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPIS 604
           PY+SP      R+YP     +GY+P+ +  VP S
Sbjct: 560 PYISPTATAGDRRYPARPDPMGYSPSEMG-VPSS 592


>SB_45203| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 668

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 3/90 (3%)
 Frame = -1

Query: 472 YDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSI 293
           +DEL   +  S Q  L   T  RD+S  F   G Y +    SL  + D VL  IS  + +
Sbjct: 292 FDELEQLDVSSIQRTLANPTGARDSSQTFANVGRYSKPP--SLIPNVDTVLRHISQWKHL 349

Query: 292 NDGNIVLASFELPRAI---SIVIPXHAQPL 212
               +    F+  R     ++ IP   QPL
Sbjct: 350 IATGLTTTPFKGVRVYVRSAMGIPVQRQPL 379


>SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1143

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 509 VSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           +S DLR SRRK    + +  Y+ A V  + +S +HG
Sbjct: 354 LSADLRNSRRKTAKKYSRTHYD-ACVTVISLSVFHG 388


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,325,591
Number of Sequences: 59808
Number of extensions: 475646
Number of successful extensions: 1174
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1077
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1169
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1949964354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -