SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.)              143   1e-34
SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.)                32   0.32 
SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14)               31   0.75 
SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09)                   30   1.3  
SB_48888| Best HMM Match : rve (HMM E-Value=6.4e-33)                   30   1.3  
SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_13623| Best HMM Match : rve (HMM E-Value=0.00044)                   30   1.3  
SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.)                30   1.7  
SB_49306| Best HMM Match : Herpes_US9 (HMM E-Value=5.7)                29   4.0  
SB_24780| Best HMM Match : Linker_histone (HMM E-Value=0.0023)         28   5.3  
SB_1788| Best HMM Match : Linker_histone (HMM E-Value=0.0023)          28   5.3  
SB_52479| Best HMM Match : Laminin_B (HMM E-Value=2.2)                 28   7.0  
SB_10493| Best HMM Match : Keratin_B2 (HMM E-Value=3.4)                28   7.0  
SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07)                   28   7.0  
SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.0  
SB_55696| Best HMM Match : SNF7 (HMM E-Value=0)                        27   9.2  
SB_55695| Best HMM Match : SNF7 (HMM E-Value=0)                        27   9.2  
SB_28528| Best HMM Match : TUDOR (HMM E-Value=0.34)                    27   9.2  
SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.2  
SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12)       27   9.2  
SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.2  

>SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 224

 Score =  143 bits (346), Expect = 1e-34
 Identities = 64/85 (75%), Positives = 75/85 (88%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           + +L+LQKRLAAS+++CGKKK+WLDPNE NEIAN NSRQN+RK+IKDGL+IKKP  VHSR
Sbjct: 29  VGTLRLQKRLAASLLKCGKKKIWLDPNECNEIANANSRQNVRKLIKDGLIIKKPEIVHSR 88

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           ARVRK  EAR KGRH G GKR+GTA
Sbjct: 89  ARVRKADEARSKGRHSGHGKRKGTA 113



 Score =  125 bits (301), Expect = 3e-29
 Identities = 60/102 (58%), Positives = 72/102 (70%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   NARMPQK +W                AKKID H+YHSLYMK+KGNVFKNKRVLMEY
Sbjct: 110 KGTANARMPQKTIWIRRMRVLRRLLRKYREAKKIDNHMYHSLYMKSKGNVFKNKRVLMEY 169

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRN 548
           IH+KKAEKAR+K+LSDQAEARRNK K A+    + +  +R++
Sbjct: 170 IHKKKAEKARSKLLSDQAEARRNKNKAAKQRRDDRMEQKRKD 211


>SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2656

 Score = 32.3 bits (70), Expect = 0.32
 Identities = 23/78 (29%), Positives = 35/78 (44%)
 Frame = -2

Query: 475  AWSLSIFVLAFSAFFLWMYSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLRTL 296
            A S+S+  L   AF ++   +S R       F F  S   R + +    ++  S  LR L
Sbjct: 1874 ALSVSLRYLYLCAFCIFALYLSLRFLYLCAIFVFALSVSLRYICLCAFCIFALSVSLRYL 1933

Query: 295  CLCTHSSFCGIRALQYLF 242
            CLC    F    +L+YL+
Sbjct: 1934 CLCAICIFAVFVSLRYLY 1951


>SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14)
          Length = 659

 Score = 31.1 bits (67), Expect = 0.75
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -3

Query: 303 EPFVFVPIVPSVAYAHCSTSSLTKATVTTLSTCLCVFADTGAGVDCYRFLDDETILDHLT 124
           +P    PI P+ +  H ++S +   T T   T   +F      ++C  F+DDE  L  L+
Sbjct: 238 KPQTSSPIGPTTSTQHQTSSPIGPTTSTQPQTSPPIFNAPCDKIECRHFIDDEHALSMLS 297

Query: 123 DVLS 112
             +S
Sbjct: 298 PPIS 301


>SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09)
          Length = 787

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +3

Query: 468 DQAEARRNKV--KEARSAARNVLPPRRRNCCRPSLEKTKPRLPLRSK 602
           D    +RN +    A  + +   PP  +N  +P ++KTKP  PL ++
Sbjct: 176 DNKPVKRNNIVLSTASWSRKTSAPPSEKNAFQPPMKKTKPSSPLLTR 222


>SB_48888| Best HMM Match : rve (HMM E-Value=6.4e-33)
          Length = 566

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = +3

Query: 483 RRNKVKEA--RSAARNVLPPRRRNCCRPSLEK 572
           R NK +E   RS AR V P  R   CRP+L K
Sbjct: 528 RNNKDRECDVRSTARQVPPTTRSTSCRPALRK 559


>SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1696

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = +3

Query: 483  RRNKVKEA--RSAARNVLPPRRRNCCRPSLEK 572
            R NK +E   RS AR V P  R   CRP+L K
Sbjct: 1658 RNNKDRECDVRSTARQVPPTTRSTSCRPALRK 1689


>SB_13623| Best HMM Match : rve (HMM E-Value=0.00044)
          Length = 203

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = +3

Query: 483 RRNKVKEA--RSAARNVLPPRRRNCCRPSLEK 572
           R NK +E   RS AR V P  R   CRP+L K
Sbjct: 165 RNNKDRECDVRSTARQVPPTTRSTSCRPALRK 196


>SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1270

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +3

Query: 444  KARTKMLSDQAEARRNKVKEARSAARNVLPPRR---RNCCRPSLEKTKPRLPLRSKH 605
            KA    L D+ EA RN++++   A+RN L  R    RN  R   E ++ R  LR +H
Sbjct: 949  KALCNRLRDRHEASRNRLRDRHEASRNRLRDRHEASRNRLRNRHEASRNR--LRDRH 1003


>SB_49306| Best HMM Match : Herpes_US9 (HMM E-Value=5.7)
          Length = 381

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 3/51 (5%)
 Frame = -2

Query: 307 LRTLCLCTHSSFCGIRALQYLFSYQSHS---DDPFYVPLCFCGHGRGSGLL 164
           LR LC C HS+  G   L +   Y  HS          LC+ GH   +G L
Sbjct: 91  LRALCYCGHSAIVG-TLLLWALCYYGHSAITGTLLLRALCYYGHSAITGTL 140


>SB_24780| Best HMM Match : Linker_histone (HMM E-Value=0.0023)
          Length = 186

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +3

Query: 396 KNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSA--ARNVLPPRR--RNCCRPS 563
           K KR + +   +K  +K+++K    +A  +RN  +  RSA   ++  P RR  R   +  
Sbjct: 113 KGKRSVRKSSVKKLTKKSKSKSRKSKASKKRNARRRPRSARKTKSRAPARRVKRTASKAP 172

Query: 564 LEKTKPRLPLRSK 602
            ++TK R   R +
Sbjct: 173 AKQTKARRSRRRR 185


>SB_1788| Best HMM Match : Linker_histone (HMM E-Value=0.0023)
          Length = 186

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +3

Query: 396 KNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSA--ARNVLPPRR--RNCCRPS 563
           K KR + +   +K  +K+++K    +A  +RN  +  RSA   ++  P RR  R   +  
Sbjct: 113 KGKRSVRKSSVKKLTKKSKSKSRKSKASKKRNARRRPRSARKTKSRAPARRVKRTASKAP 172

Query: 564 LEKTKPRLPLRSK 602
            ++TK R   R +
Sbjct: 173 AKQTKARRSRRRR 185


>SB_52479| Best HMM Match : Laminin_B (HMM E-Value=2.2)
          Length = 465

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%)
 Frame = +1

Query: 124 RKMIKDGLVIKKPVAVHSR-ARVRKNTEARRKG-RHCGFGKRRGTAMRVCHRRNYGY 288
           RK+IK+  + KKP   H + A   K  E    G +   F +++G   ++  +RN  Y
Sbjct: 224 RKLIKESEMSKKPTVGHQKEAGYHKAPEREFLGEKRLLFERKKGAEKQLLQKRNENY 280


>SB_10493| Best HMM Match : Keratin_B2 (HMM E-Value=3.4)
          Length = 119

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 16/65 (24%), Positives = 27/65 (41%)
 Frame = -3

Query: 390 HYPSPSCRVSGIDACQSSWQFCTSGAIFLEPFVFVPIVPSVAYAHCSTSSLTKATVTTLS 211
           H   P   +  + ACQ ++  C S ++FL       +   V+ +   T       VT L 
Sbjct: 41  HSLDPCACICHVSACQRAFVTCLSVSVFLSRVNLSRVCVLVSVSVSVTCVNLYLPVTCLR 100

Query: 210 TCLCV 196
            C+C+
Sbjct: 101 ACVCL 105


>SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07)
          Length = 807

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -3

Query: 342 SSWQFCTSGAIFLEPFVFVPIVPSVAYAHC 253
           ++W FC  G    E F    ++P   Y HC
Sbjct: 421 AAWNFCPDGKWSWEYFDATVVIPPPPYGHC 450


>SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 358

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = -3

Query: 354 DACQSSWQFCTSGAIFLEPF-VFVPIVPSVAYAH 256
           D  + S Q C     FLEP  VF P+ PS A+AH
Sbjct: 192 DIVEKSQQACREHEAFLEPMGVFSPLPPS-AHAH 224


>SB_55696| Best HMM Match : SNF7 (HMM E-Value=0)
          Length = 225

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +3

Query: 378 AKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARN 524
           AK NV KNKR+ ++ + RKK  +   K LS Q +   + ++  R A  N
Sbjct: 61  AKANVKKNKRIALQALKRKKRLE---KQLS-QIDGTLSTIEFQRDALEN 105


>SB_55695| Best HMM Match : SNF7 (HMM E-Value=0)
          Length = 225

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +3

Query: 378 AKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARN 524
           AK NV KNKR+ ++ + RKK  +   K LS Q +   + ++  R A  N
Sbjct: 61  AKANVKKNKRIALQALKRKKRLE---KQLS-QIDGTLSTIEFQRDALEN 105


>SB_28528| Best HMM Match : TUDOR (HMM E-Value=0.34)
          Length = 736

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = +3

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLP 533
           F+  +  MEY  +   EKA  K+   Q++A R K+  +  A   ++P
Sbjct: 80  FQKAKEAMEYARKSATEKAAEKIQDIQSQAARIKLTVSIQAPFIIIP 126


>SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 608

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 15/51 (29%), Positives = 23/51 (45%)
 Frame = +3

Query: 381 KGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLP 533
           K     NK    E   +    K +TK   D+ +  +NK KE ++A R + P
Sbjct: 496 KDKTKNNKDKTKENKDKTNENKDKTKENKDKTKENKNKTKENKTANRPLTP 546


>SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12)
          Length = 1206

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -3

Query: 369 RVSGIDACQSSWQFCTSGAIFLEPFVF 289
           RV+G+    S WQ CT+ A  L+  VF
Sbjct: 493 RVAGVKKSPSRWQQCTNAANNLDGLVF 519


>SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 979

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 15/74 (20%), Positives = 30/74 (40%)
 Frame = +3

Query: 339 KIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAA 518
           +  R  Y +LY   KGN F +   L++       E+ R K         + ++++  +  
Sbjct: 70  EFQRKRYGNLYQLLKGNTFTDAEDLVKLWDAAHYEEERAKKRKPLTPLAKFRIRQRFTPP 129

Query: 519 RNVLPPRRRNCCRP 560
           + + P  R+    P
Sbjct: 130 KTICPKGRQKSTLP 143


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,486,295
Number of Sequences: 59808
Number of extensions: 420329
Number of successful extensions: 1394
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1262
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1384
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1524174750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -