SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5)                    46   3e-05
SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51)                   46   3e-05
SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36)                   29   4.1  
SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_16259| Best HMM Match : AAA (HMM E-Value=0.43)                      28   7.2  
SB_14677| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)           28   7.2  
SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_58863| Best HMM Match : Fibrinogen_BP (HMM E-Value=2)               27   9.5  
SB_53612| Best HMM Match : SRCR (HMM E-Value=0)                        27   9.5  
SB_43376| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  

>SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5)
          Length = 85

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402
           +Q+QAD+LGI V RP M E+TALGAA+ AG A  + VW
Sbjct: 25  MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62


>SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51)
          Length = 137

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402
           +Q+QAD+LGI V RP M E+TALGAA+ AG A  + VW
Sbjct: 25  MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62


>SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 566

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402
           +Q+QAD+LGI V RP M E+TALGAA+ AG A  + VW
Sbjct: 436 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 473



 Score = 34.7 bits (76), Expect = 0.063
 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 628 RAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           RA LEAVC QTR            PL  LL DGGM  N +L
Sbjct: 395 RATLEAVCFQTRELLDAMNEDCGIPLASLLVDGGMTVNRLL 435


>SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1940

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 22/83 (26%), Positives = 33/83 (39%), Gaps = 9/83 (10%)
 Frame = +1

Query: 403  HTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSS---------APSLRRRGVAS 555
            H  +  P  +A P  ++S+  G ++G  + +    T   S          PS R   +  
Sbjct: 1637 HPSMLMPHPLAMPGLMMSMSSGMISGSNTSTTTTATSSRSRDPDSSPYRTPSDRSSPLTV 1696

Query: 556  GARSLQPSRPPRRASGDTRPPAR 624
            G RS +P  PPR      R P R
Sbjct: 1697 GGRSSRPRSPPRLMEPRPRSPVR 1719


>SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3486

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = -3

Query: 626  GRAGGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLG 483
            GR GGR+   A R GR+G R+++     R  R+G  + S+  ++   G
Sbjct: 1781 GRNGGRMKSLANRSGRNGGRMKS--LAHRSMRNGGRMKSLAHRSSRKG 1826


>SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +++ + L G  + RP   + + LGAA +AG A  VW
Sbjct: 21  MELTSSLTGQSMDRPSQTDMSVLGAAFLAGMATGVW 56


>SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 516

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = -3

Query: 626 GRAGGRVSPDARRGGRDGCRLRAPEATPRR 537
           GR GGR      RGGR G R  A EA+P R
Sbjct: 421 GRGGGRGG--GGRGGRGGLRGEASEASPNR 448


>SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 964

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%)
 Frame = +3

Query: 363 QECIGRW--AGYCRGPHTHCATC 425
           QEC+GRW  A + RG H  C  C
Sbjct: 26  QECLGRWNVAQFFRGRHPTCPHC 48


>SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36)
          Length = 924

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/54 (25%), Positives = 23/54 (42%)
 Frame = +1

Query: 466  GRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARP 627
            GR + +  +    C   ++AP + + G   G  +  PS PP  +   T  P  P
Sbjct: 840  GRESTVSLRDLAPCPPQNTAPQMSQEGTFQGQAAPTPSTPPTDSGLKTPAPILP 893


>SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3235

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +1

Query: 508  TELSSAPSLRRRGVASGARSLQPSRPP 588
            T L++ PS R+ G +S A++ +PS PP
Sbjct: 3156 TVLTTLPSSRQAGTSSTAKATRPSVPP 3182


>SB_16259| Best HMM Match : AAA (HMM E-Value=0.43)
          Length = 538

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 18/50 (36%), Positives = 23/50 (46%)
 Frame = -2

Query: 543 SPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSPGGGHCRRSRNACVAHD 394
           SP  G+R T F    G  T +   +S H  + S  G      RNACV+ D
Sbjct: 484 SPYLGFRSTSF-TPLG--TAFAYMASVHTRRTSSRGNRLNMRRNACVSQD 530


>SB_14677| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 327

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/54 (24%), Positives = 23/54 (42%)
 Frame = +1

Query: 466 GRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARP 627
           GR + +  +    C   ++AP + + G   G  +  P+ PP  +   T  P  P
Sbjct: 244 GRESTVSLRDLASCPPQNTAPQMSQEGTFQGQAAPTPTTPPTDSGLKTPAPILP 297


>SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)
          Length = 456

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = -1

Query: 502 CRLIYWVYQSFVPS*WKVQPWGRPLSQVAQCVCGPRQYPAHRPIHSCRLLPMKNEKCGEF 323
           CR +   +Q  VP+  + Q WG  + +  +C    +Q    R  H  +LL  +  +CGE+
Sbjct: 290 CRQVAVYHQRGVPT-LEEQEWGVGVVEEYKCPTCSQQIRFPRYNHPAKLLETRCGRCGEW 348


>SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3293

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +1

Query: 385  LGIVVGHTRIARPATMAAPRAVLSIMRGRMTGI 483
            +G+ + HTR+A  +   A   VLSI R R+ G+
Sbjct: 1618 VGLSIHHTRLADVSIHHARLGVLSIHRSRLVGL 1650


>SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 825

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = +3

Query: 351 GKSRQECIGRWAGYCRGPHTHCAT 422
           G + Q C G  AGYC  P  HC T
Sbjct: 751 GSAAQHC-GTNAGYCGIPSNHCGT 773


>SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1300

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 10/27 (37%), Positives = 13/27 (48%)
 Frame = +3

Query: 387 GYCRGPHTHCATCDNGRPQGCTFHHEG 467
           G C+     C TC    P+ CTF  +G
Sbjct: 470 GICKSCDPGCTTCSTSDPKKCTFCAKG 496


>SB_58863| Best HMM Match : Fibrinogen_BP (HMM E-Value=2)
          Length = 1037

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +1

Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624
           +S+ + RRR +A  ARSL  S P  R  G   P  R
Sbjct: 632 ASSRAQRRRSLAHSARSLPGSMPSDRDLGRKNPQGR 667


>SB_53612| Best HMM Match : SRCR (HMM E-Value=0)
          Length = 409

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 19/60 (31%), Positives = 35/60 (58%)
 Frame = +1

Query: 406 TRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRP 585
           T+++ P + +AP A  +I++ ++ G+ S ++   T   S+P  +R   A+ A S QPS P
Sbjct: 342 TQLSTPES-SAP-ADEAILKMKLQGLASSASTPATP-DSSPKRKRTRQANSASSSQPSSP 398


>SB_43376| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 196

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 13/54 (24%), Positives = 23/54 (42%)
 Frame = +1

Query: 466 GRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARP 627
           GR + +  +    C   ++AP + + G   G  +  P+ PP  +   T  P  P
Sbjct: 112 GRESTVSLRDLAPCPPQNTAPQMSQEGTFQGQAAPTPTTPPTDSGLKTPAPILP 165


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,993,027
Number of Sequences: 59808
Number of extensions: 456669
Number of successful extensions: 1257
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 1114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1251
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1572561250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -