SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30090.Seq
         (437 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.9  
SB_51816| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-24)                 27   6.8  
SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.9  

>SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1383

 Score = 27.9 bits (59), Expect = 3.9
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = +3

Query: 207 KAHRNGIKKPRKTRH 251
           K HRNGIKKPR  R+
Sbjct: 175 KWHRNGIKKPRTNRY 189


>SB_51816| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-24)
          Length = 384

 Score = 27.1 bits (57), Expect = 6.8
 Identities = 14/48 (29%), Positives = 22/48 (45%)
 Frame = -1

Query: 323 LASGXPSCKTFDSLKILDPCQGWFVPGLPWLFDTISVSFAVLVMICMI 180
           L  G P         IL    G+FV G  +L+ T  +   V+++IC +
Sbjct: 146 LLPGLPLLALLSDKVILVYFPGFFVCGQEFLYPTGQIELGVIILICTL 193


>SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 451

 Score = 26.6 bits (56), Expect = 8.9
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +3

Query: 189 NHNQNRKAHRNGIKKPRKTRHE 254
           +HN  +   R GIK+PR+++ E
Sbjct: 350 SHNNQQNDSRRGIKRPRRSQEE 371


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,589,169
Number of Sequences: 59808
Number of extensions: 175651
Number of successful extensions: 443
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 423
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 443
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 847047381
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -