SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30080.Seq
         (853 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_6006| Best HMM Match : Annexin (HMM E-Value=2.4e-25)                29   4.8  
SB_28488| Best HMM Match : PAX (HMM E-Value=0)                         29   6.3  

>SB_6006| Best HMM Match : Annexin (HMM E-Value=2.4e-25)
          Length = 803

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +1

Query: 205 KARXQAKGLXKXDQXGRKEDKGKPEXKPAKGVTVPTRKGIKETQNVKSQXIKSGEQQK 378
           K + Q     K  + GRKE+K K E K         ++  K+  N K +  KS E++K
Sbjct: 285 KGQGQKVEKAKKQEKGRKEEKSKKEEKEKN--KAGGKEAKKDKANEKDKDAKSKEEEK 340


>SB_28488| Best HMM Match : PAX (HMM E-Value=0)
          Length = 551

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 12/49 (24%), Positives = 25/49 (51%)
 Frame = +1

Query: 235 KXDQXGRKEDKGKPEXKPAKGVTVPTRKGIKETQNVKSQXIKSGEQQKG 381
           K ++   ++DKGK + K  K  ++P+R     + ++ S   K   ++ G
Sbjct: 171 KKERKDEEDDKGKEDEKVEKNSSLPSRHNFSSSYSIASILKKPSAEEDG 219


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,924,680
Number of Sequences: 59808
Number of extensions: 297349
Number of successful extensions: 434
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 396
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 434
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2419355818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -