SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30079.Seq
         (413 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.001
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.002
SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.002
SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.002
SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.002
SB_2190| Best HMM Match : SGS (HMM E-Value=2.5)                        38   0.002
SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.003
SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.004
SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.004
SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.006
SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.006
SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.008
SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.)               37   0.008
SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.008
SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.008
SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.008
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.010
SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.010
SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.010
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.013
SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.013
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2)                    36   0.017
SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8)             36   0.017
SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.017
SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.017
SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.017
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               35   0.023
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14)           35   0.023
SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.023
SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6)               35   0.023
SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.023
SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)                 35   0.030
SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.030
SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3)                    35   0.030
SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.030
SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9)                   35   0.030
SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.030
SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.030
SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.030
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)                    34   0.040
SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.040
SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05)                 34   0.040
SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8)            34   0.040
SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15)                  34   0.040
SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_12453| Best HMM Match : DUF765 (HMM E-Value=5)                      34   0.040
SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.040
SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38)                  34   0.040
SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09)                   34   0.040
SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.040
SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.040
SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5)                      34   0.040
SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12)            34   0.040
SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.040
SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.040
SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.040
SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.040
SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.)                34   0.040
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                    34   0.053
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)                34   0.053
SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6)                   34   0.053
SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4)              34   0.053
SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18)                 34   0.053
SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3)                      34   0.053
SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.)                34   0.053
SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9)                    34   0.053
SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12)                34   0.053
SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11)         34   0.053
SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7)                   34   0.053
SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.053
SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.053
SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.)                34   0.053
SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.)                34   0.053
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)                    33   0.070
SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2)                    33   0.070
SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7)               33   0.070
SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8)                      33   0.070
SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6)                    33   0.070
SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9)                    33   0.070
SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_18514| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4)                    33   0.070
SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.070
SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_4204| Best HMM Match : DUF765 (HMM E-Value=8)                       33   0.070
SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.070
SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.)                33   0.070
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                     33   0.093
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                        33   0.093
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                    33   0.093
SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                    33   0.093
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)                      33   0.093
SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8)                    33   0.093
SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)                    33   0.093
SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)                 33   0.093
SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)                   33   0.093
SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)                 33   0.093
SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016)                   33   0.093
SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076)                    33   0.093
SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4)                   33   0.093
SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5)                      33   0.093
SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13)                  33   0.093
SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4)                       33   0.093
SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    33   0.093
SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061)                  33   0.093
SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8)               33   0.093
SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_14086| Best HMM Match : POR (HMM E-Value=7.7)                       33   0.093
SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14)         33   0.093
SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2)                     33   0.093
SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1)                33   0.093
SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_4586| Best HMM Match : DUF765 (HMM E-Value=7)                       33   0.093
SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002)                     33   0.093
SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.093
SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29)        33   0.093
SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093
SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.093

>SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 39.1 bits (87), Expect = 0.001
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = -1

Query: 110 FKLGNLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           F+ G+LTT      +R  L+ NSC+PG PL+LERPP
Sbjct: 7   FRCGHLTTNAAT-RVRFPLISNSCSPGDPLVLERPP 41


>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 38.7 bits (86), Expect = 0.002
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = -1

Query: 77 NDSLRGLLVPNSCTPGXPLLLERPP 3
          N + R  LV NSC+PG PL+LERPP
Sbjct: 17 NPNTRAHLVSNSCSPGDPLVLERPP 41


>SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 38.7 bits (86), Expect = 0.002
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          ++ D+L   L  NSC+PG PL+LERPP
Sbjct: 6  YETDALPTALTSNSCSPGDPLVLERPP 32


>SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 38.7 bits (86), Expect = 0.002
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = -1

Query: 101 GNLTTVFDNDSLRGL---LVPNSCTPGXPLLLERPP 3
           GNL  VF  D +R L   L+ NSC+PG PL+LERPP
Sbjct: 20  GNLDDVFVRD-IRILFLDLISNSCSPGDPLVLERPP 54


>SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 38.7 bits (86), Expect = 0.002
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = -1

Query: 98  NLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           N+ T +   S R  LV NSC+PG PL+LERPP
Sbjct: 12  NIPTRYAILSPRARLVSNSCSPGDPLVLERPP 43


>SB_2190| Best HMM Match : SGS (HMM E-Value=2.5)
          Length = 221

 Score = 38.3 bits (85), Expect = 0.002
 Identities = 13/29 (44%), Positives = 22/29 (75%)
 Frame = -1

Query: 89  TVFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           +++ ++ ++  L  NSC+PG PL+LERPP
Sbjct: 85  SIYGHEDIKRALASNSCSPGDPLVLERPP 113


>SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 37.9 bits (84), Expect = 0.003
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = -1

Query: 65 RGLLVPNSCTPGXPLLLERPP 3
          R +LV NSC+PG PL+LERPP
Sbjct: 23 RPMLVSNSCSPGDPLVLERPP 43


>SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          LLV NSC+PG PL+LERPP
Sbjct: 16 LLVSNSCSPGDPLVLERPP 34


>SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 14/23 (60%), Positives = 19/23 (82%)
 Frame = -1

Query: 71 SLRGLLVPNSCTPGXPLLLERPP 3
          +L  L++ NSC+PG PL+LERPP
Sbjct: 21 TLGSLIISNSCSPGDPLVLERPP 43


>SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 37.1 bits (82), Expect = 0.006
 Identities = 16/25 (64%), Positives = 22/25 (88%)
 Frame = -1

Query: 77 NDSLRGLLVPNSCTPGXPLLLERPP 3
          +++LR +LV NSC+PG PL+LERPP
Sbjct: 3  HNTLR-ILVSNSCSPGDPLVLERPP 26


>SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 37.1 bits (82), Expect = 0.006
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 77 NDSLRGLLVPNSCTPGXPLLLERPP 3
          N  +RG    NSC+PG PL+LERPP
Sbjct: 11 NPEVRGSKPSNSCSPGDPLVLERPP 35


>SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 447

 Score = 36.7 bits (81), Expect = 0.008
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = -1

Query: 74  DSLRG-LLVPNSCTPGXPLLLERPP 3
           D  +G LL  NSC+PG PL+LERPP
Sbjct: 71  DECKGILLTSNSCSPGDPLVLERPP 95


>SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 36.7 bits (81), Expect = 0.008
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = -1

Query: 86  VFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           VF ++S     V NSC+PG PL+LERPP
Sbjct: 21  VFYSNSTPHFRVSNSCSPGDPLVLERPP 48


>SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 36.7 bits (81), Expect = 0.008
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +LV NSC+PG PL+LERPP
Sbjct: 4  MLVSNSCSPGDPLVLERPP 22


>SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 36.7 bits (81), Expect = 0.008
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +LV NSC+PG PL+LERPP
Sbjct: 1  MLVSNSCSPGDPLVLERPP 19


>SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 36.7 bits (81), Expect = 0.008
 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
 Frame = -1

Query: 92 TTVFDNDSLRGLLVP-NSCTPGXPLLLERPP 3
          T +  N  LRG+    NSC+PG PL+LERPP
Sbjct: 7  TLISANIRLRGICAASNSCSPGDPLVLERPP 37


>SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 36.3 bits (80), Expect = 0.010
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = -1

Query: 65 RGLLVPNSCTPGXPLLLERPP 3
          RG+   NSC+PG PL+LERPP
Sbjct: 30 RGVHASNSCSPGDPLVLERPP 50


>SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 213

 Score = 36.3 bits (80), Expect = 0.010
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = -1

Query: 74  DSLRGLLVPNSCTPGXPLLLERPP 3
           D+   LL  NSC+PG PL+LERPP
Sbjct: 82  DASNLLLTSNSCSPGDPLVLERPP 105


>SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 36.3 bits (80), Expect = 0.010
 Identities = 14/23 (60%), Positives = 18/23 (78%)
 Frame = -1

Query: 71 SLRGLLVPNSCTPGXPLLLERPP 3
          +L   L+ NSC+PG PL+LERPP
Sbjct: 2  ALSSFLLSNSCSPGDPLVLERPP 24


>SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = -1

Query: 68 LRGLLVPNSCTPGXPLLLERPP 3
          L   L+ NSC+PG PL+LERPP
Sbjct: 13 LISFLISNSCSPGDPLVLERPP 34


>SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 8  LFVSNSCSPGDPLVLERPP 26


>SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          LV NSC+PG PL+LERPP
Sbjct: 3  LVSNSCSPGDPLVLERPP 20


>SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = -1

Query: 68 LRGLLVPNSCTPGXPLLLERPP 3
          L+ L+  NSC+PG PL+LERPP
Sbjct: 16 LKLLITSNSCSPGDPLVLERPP 37


>SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = -1

Query: 65 RGLLVPNSCTPGXPLLLERPP 3
          R L + NSC+PG PL+LERPP
Sbjct: 4  RRLFLSNSCSPGDPLVLERPP 24


>SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 15/21 (71%), Positives = 18/21 (85%), Gaps = 1/21 (4%)
 Frame = -1

Query: 62 GLLVP-NSCTPGXPLLLERPP 3
          GL +P NSC+PG PL+LERPP
Sbjct: 4  GLFLPSNSCSPGDPLVLERPP 24


>SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/20 (70%), Positives = 16/20 (80%)
 Frame = -1

Query: 62 GLLVPNSCTPGXPLLLERPP 3
          G  V NSC+PG PL+LERPP
Sbjct: 31 GFKVSNSCSPGDPLVLERPP 50


>SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          LL  NSC+PG PL+LERPP
Sbjct: 4  LLASNSCSPGDPLVLERPP 22


>SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = -1

Query: 68 LRGLLVPNSCTPGXPLLLERPP 3
          +R  L+ NSC+PG PL+LERPP
Sbjct: 4  VRIYLISNSCSPGDPLVLERPP 25


>SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 16/28 (57%), Positives = 19/28 (67%)
 Frame = -1

Query: 86  VFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           V D D+L      NSC+PG PL+LERPP
Sbjct: 31  VLDLDALDTTQGSNSCSPGDPLVLERPP 58


>SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F+N   R   V NSC+PG PL+LERPP
Sbjct: 5  FENRIGRCWQVSNSCSPGDPLVLERPP 31


>SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 15/22 (68%), Positives = 17/22 (77%)
 Frame = -1

Query: 68 LRGLLVPNSCTPGXPLLLERPP 3
          LR L   NSC+PG PL+LERPP
Sbjct: 31 LRKLCESNSCSPGDPLVLERPP 52


>SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 35.9 bits (79), Expect = 0.013
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = -1

Query: 107 KLGNLTTVFDNDSLR-GLLVPNSCTPGXPLLLERPP 3
           KL  +  V D   L  G  + NSC+PG PL+LERPP
Sbjct: 4   KLTEMCAVRDTSILSAGRSLSNSCSPGDPLVLERPP 39


>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = -1

Query: 65  RGLLVPNSCTPGXPLLLERPP 3
           + L + NSC+PG PL+LERPP
Sbjct: 97  KSLKISNSCSPGDPLVLERPP 117


>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2)
          Length = 558

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 95  LTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           +T +   +   G    NSC+PG PL+LERPP
Sbjct: 465 VTRLLQGEIASGQTTSNSCSPGDPLVLERPP 495


>SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = -1

Query: 71  SLRGLLVPNSCTPGXPLLLERPP 3
           S +   + NSC+PG PL+LERPP
Sbjct: 41  SKKNFFISNSCSPGDPLVLERPP 63


>SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +++ NSC+PG PL+LERPP
Sbjct: 13 IIISNSCSPGDPLVLERPP 31


>SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%)
 Frame = -1

Query: 80  DNDSLRGLL-VPNSCTPGXPLLLERPP 3
           +N SL+    + NSC+PG PL+LERPP
Sbjct: 22  ENSSLKPTFSISNSCSPGDPLVLERPP 48


>SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 2  LYVSNSCSPGDPLVLERPP 20


>SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +L+ NSC+PG PL+LERPP
Sbjct: 5  ILLSNSCSPGDPLVLERPP 23


>SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8)
          Length = 351

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = -1

Query: 110 FKLGNLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           FK+ N       +  + L   NSC+PG PL+LERPP
Sbjct: 208 FKVSNTPAAEQRNYTQLLESSNSCSPGDPLVLERPP 243


>SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 40 LISNSCSPGDPLVLERPP 57


>SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           L+ NSC+PG PL+LERPP
Sbjct: 70  LISNSCSPGDPLVLERPP 87


>SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 34 LISNSCSPGDPLVLERPP 51


>SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F +  +   +V NSC+PG PL+LERPP
Sbjct: 4  FTDTLISANIVSNSCSPGDPLVLERPP 30


>SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 21 LISNSCSPGDPLVLERPP 38


>SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 16 LISNSCSPGDPLVLERPP 33


>SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 33 LISNSCSPGDPLVLERPP 50


>SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 35.5 bits (78), Expect = 0.017
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 31 LISNSCSPGDPLVLERPP 48


>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 3/29 (10%)
 Frame = -1

Query: 80  DNDSLRGLLVP---NSCTPGXPLLLERPP 3
           DN +    LVP   NSC+PG PL+LERPP
Sbjct: 14  DNGTNGASLVPRPSNSCSPGDPLVLERPP 42


>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
          Length = 472

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           +V NSC+PG PL+LERPP
Sbjct: 347 IVSNSCSPGDPLVLERPP 364


>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          LL  NSC+PG PL+LERPP
Sbjct: 24 LLPSNSCSPGDPLVLERPP 42


>SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 164

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 38 LRVSNSCSPGDPLVLERPP 56


>SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +++ NSC+PG PL+LERPP
Sbjct: 13 IVISNSCSPGDPLVLERPP 31


>SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/22 (59%), Positives = 17/22 (77%)
 Frame = -1

Query: 68 LRGLLVPNSCTPGXPLLLERPP 3
          +R +   NSC+PG PL+LERPP
Sbjct: 3  MRVIFTSNSCSPGDPLVLERPP 24


>SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           +V NSC+PG PL+LERPP
Sbjct: 77  IVSNSCSPGDPLVLERPP 94


>SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 62 GLLVPNSCTPGXPLLLERPP 3
          G+   NSC+PG PL+LERPP
Sbjct: 7  GIKTSNSCSPGDPLVLERPP 26


>SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F +  +   ++ NSC+PG PL+LERPP
Sbjct: 4  FTDTLISANIISNSCSPGDPLVLERPP 30


>SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          ++V NSC+PG PL+LERPP
Sbjct: 6  VVVSNSCSPGDPLVLERPP 24


>SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          +V NSC+PG PL+LERPP
Sbjct: 11 MVSNSCSPGDPLVLERPP 28


>SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = -1

Query: 68 LRGLLVPNSCTPGXPLLLERPP 3
          +R L   NSC+PG PL+LERPP
Sbjct: 24 IRSLQRSNSCSPGDPLVLERPP 45


>SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14)
          Length = 190

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = -1

Query: 95  LTTVFDND-SLRGLLVPNSCTPGXPLLLERPP 3
           LT V  N  +L   ++ NSC+PG PL+LERPP
Sbjct: 51  LTLVITNLLALTVFMLSNSCSPGDPLVLERPP 82


>SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          +V NSC+PG PL+LERPP
Sbjct: 1  MVSNSCSPGDPLVLERPP 18


>SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +++ NSC+PG PL+LERPP
Sbjct: 4  VIISNSCSPGDPLVLERPP 22


>SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 62 GLLVPNSCTPGXPLLLERPP 3
          G+   NSC+PG PL+LERPP
Sbjct: 8  GIRTSNSCSPGDPLVLERPP 27


>SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 16 LKVSNSCSPGDPLVLERPP 34


>SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 210

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           +V NSC+PG PL+LERPP
Sbjct: 85  IVSNSCSPGDPLVLERPP 102


>SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +L  NSC+PG PL+LERPP
Sbjct: 10 MLASNSCSPGDPLVLERPP 28


>SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = -1

Query: 80 DN-DSLRGLLVPNSCTPGXPLLLERPP 3
          DN +  R L   NSC+PG PL+LERPP
Sbjct: 5  DNLEGSRRLQTSNSCSPGDPLVLERPP 31


>SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          +V NSC+PG PL+LERPP
Sbjct: 6  IVSNSCSPGDPLVLERPP 23


>SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          +V NSC+PG PL+LERPP
Sbjct: 1  MVSNSCSPGDPLVLERPP 18


>SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          LL  NSC+PG PL+LERPP
Sbjct: 21 LLPSNSCSPGDPLVLERPP 39


>SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 192

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = -1

Query: 80  DNDSLRGLLVPNSCTPGXPLLLERPP 3
           D + ++ + + NSC+PG PL+LERPP
Sbjct: 59  DLNIIQKIKISNSCSPGDPLVLERPP 84


>SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F +  +   ++ NSC+PG PL+LERPP
Sbjct: 4  FTDTLISANIISNSCSPGDPLVLERPP 30


>SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 7  LRVSNSCSPGDPLVLERPP 25


>SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +++ NSC+PG PL+LERPP
Sbjct: 24 IVISNSCSPGDPLVLERPP 42


>SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6)
          Length = 270

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59  LLVPNSCTPGXPLLLERPP 3
           L+  NSC+PG PL+LERPP
Sbjct: 144 LITSNSCSPGDPLVLERPP 162


>SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = -1

Query: 77 NDSLRGLL-VPNSCTPGXPLLLERPP 3
          N S + LL + NSC+PG PL+LERPP
Sbjct: 3  NQSKQCLLEISNSCSPGDPLVLERPP 28


>SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 35.1 bits (77), Expect = 0.023
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L+  NSC+PG PL+LERPP
Sbjct: 5  LITSNSCSPGDPLVLERPP 23


>SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          ++ NSC+PG PL+LERPP
Sbjct: 17 IISNSCSPGDPLVLERPP 34


>SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)
          Length = 1016

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59  LLVPNSCTPGXPLLLERPP 3
           L+  NSC+PG PL+LERPP
Sbjct: 890 LVTSNSCSPGDPLVLERPP 908


>SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           L+ NSC+PG PL+LERPP
Sbjct: 62  LLSNSCSPGDPLVLERPP 79


>SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 346

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           ++ NSC+PG PL+LERPP
Sbjct: 119 IISNSCSPGDPLVLERPP 136


>SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 214

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = -1

Query: 74  DSLRGLLVP-NSCTPGXPLLLERPP 3
           D LR  +V  NSC+PG PL+LERPP
Sbjct: 82  DLLRPCIVTSNSCSPGDPLVLERPP 106


>SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3889

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56   LVPNSCTPGXPLLLERPP 3
            +V NSC+PG PL+LERPP
Sbjct: 3474 VVSNSCSPGDPLVLERPP 3491


>SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 3  LHVSNSCSPGDPLVLERPP 21


>SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 5  LHVSNSCSPGDPLVLERPP 23


>SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 14/22 (63%), Positives = 16/22 (72%)
 Frame = -1

Query: 68 LRGLLVPNSCTPGXPLLLERPP 3
          L   L  NSC+PG PL+LERPP
Sbjct: 2  LYNTLASNSCSPGDPLVLERPP 23


>SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L + NSC+PG PL+LERPP
Sbjct: 4  LFLSNSCSPGDPLVLERPP 22


>SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           L+ NSC+PG PL+LERPP
Sbjct: 54  LLSNSCSPGDPLVLERPP 71


>SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 2  LLSNSCSPGDPLVLERPP 19


>SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +L  NSC+PG PL+LERPP
Sbjct: 16 VLASNSCSPGDPLVLERPP 34


>SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          +V NSC+PG PL+LERPP
Sbjct: 19 VVSNSCSPGDPLVLERPP 36


>SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 62 GLLVPNSCTPGXPLLLERPP 3
          G +  NSC+PG PL+LERPP
Sbjct: 10 GFVPSNSCSPGDPLVLERPP 29


>SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3)
          Length = 138

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 15/24 (62%), Positives = 17/24 (70%)
 Frame = -1

Query: 74 DSLRGLLVPNSCTPGXPLLLERPP 3
          DS     V NSC+PG PL+LERPP
Sbjct: 7  DSNMCSFVSNSCSPGDPLVLERPP 30


>SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 62 GLLVPNSCTPGXPLLLERPP 3
          G +  NSC+PG PL+LERPP
Sbjct: 14 GPITSNSCSPGDPLVLERPP 33


>SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +L  NSC+PG PL+LERPP
Sbjct: 36 VLTSNSCSPGDPLVLERPP 54


>SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F+ DS +     NSC+PG PL+LERPP
Sbjct: 8  FEPDSNQRPRESNSCSPGDPLVLERPP 34


>SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          + V NSC+PG PL+LERPP
Sbjct: 30 IAVSNSCSPGDPLVLERPP 48


>SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 402

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59  LLVPNSCTPGXPLLLERPP 3
           L + NSC+PG PL+LERPP
Sbjct: 169 LFLSNSCSPGDPLVLERPP 187


>SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = -1

Query: 74 DSLRGLLVPNSCTPGXPLLLERPP 3
          +  R   V NSC+PG PL+LERPP
Sbjct: 3  EEFRITAVSNSCSPGDPLVLERPP 26


>SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          ++ NSC+PG PL+LERPP
Sbjct: 1  MISNSCSPGDPLVLERPP 18


>SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L+  NSC+PG PL+LERPP
Sbjct: 19 LVASNSCSPGDPLVLERPP 37


>SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L V NSC+PG PL+LERPP
Sbjct: 12 LEVSNSCSPGDPLVLERPP 30


>SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L+ NSC+PG PL+LERPP
Sbjct: 1  LLSNSCSPGDPLVLERPP 18


>SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          ++ NSC+PG PL+LERPP
Sbjct: 4  IISNSCSPGDPLVLERPP 21


>SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 15/19 (78%), Positives = 17/19 (89%), Gaps = 1/19 (5%)
 Frame = -1

Query: 56 LVP-NSCTPGXPLLLERPP 3
          LVP NSC+PG PL+LERPP
Sbjct: 27 LVPSNSCSPGDPLVLERPP 45


>SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9)
          Length = 283

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = -1

Query: 77  NDSLRGLLVPNSCTPGXPLLLERPP 3
           N  ++  +  NSC+PG PL+LERPP
Sbjct: 151 NKYIKQWIASNSCSPGDPLVLERPP 175


>SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          +V NSC+PG PL+LERPP
Sbjct: 27 VVSNSCSPGDPLVLERPP 44


>SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = -1

Query: 95  LTTVFDNDSLRGLLVP-NSCTPGXPLLLERPP 3
           LTT    ++ R + V  NSC+PG PL+LERPP
Sbjct: 36  LTTRIHYENKRRVYVTSNSCSPGDPLVLERPP 67


>SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 34.7 bits (76), Expect = 0.030
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +L  NSC+PG PL+LERPP
Sbjct: 3  VLASNSCSPGDPLVLERPP 21


>SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 30 VSNSCSPGDPLVLERPP 46


>SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 7  VSNSCSPGDPLVLERPP 23


>SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)
          Length = 139

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 15 VSNSCSPGDPLVLERPP 31


>SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = -1

Query: 65  RGLLVPNSCTPGXPLLLERPP 3
           R ++  NSC+PG PL+LERPP
Sbjct: 43  RVVVTSNSCSPGDPLVLERPP 63


>SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F +  +   ++ NSC+PG PL+LERPP
Sbjct: 4  FTDTLISANILSNSCSPGDPLVLERPP 30


>SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 2  VSNSCSPGDPLVLERPP 18


>SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          + + NSC+PG PL+LERPP
Sbjct: 7  ITISNSCSPGDPLVLERPP 25


>SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 241

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           V NSC+PG PL+LERPP
Sbjct: 117 VSNSCSPGDPLVLERPP 133


>SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 308

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           V NSC+PG PL+LERPP
Sbjct: 184 VSNSCSPGDPLVLERPP 200


>SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1407

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53   VPNSCTPGXPLLLERPP 3
            V NSC+PG PL+LERPP
Sbjct: 1066 VSNSCSPGDPLVLERPP 1082


>SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 3  VSNSCSPGDPLVLERPP 19


>SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05)
          Length = 680

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           V NSC+PG PL+LERPP
Sbjct: 214 VSNSCSPGDPLVLERPP 230


>SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 3  VSNSCSPGDPLVLERPP 19


>SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           V NSC+PG PL+LERPP
Sbjct: 64  VSNSCSPGDPLVLERPP 80


>SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = -1

Query: 62 GLLVPNSCTPGXPLLLERPP 3
          G    NSC+PG PL+LERPP
Sbjct: 17 GRFASNSCSPGDPLVLERPP 36


>SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 4  VSNSCSPGDPLVLERPP 20


>SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 19 VSNSCSPGDPLVLERPP 35


>SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 190

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59  LLVPNSCTPGXPLLLERPP 3
           +L  NSC+PG PL+LERPP
Sbjct: 64  ILPSNSCSPGDPLVLERPP 82


>SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 11 VSNSCSPGDPLVLERPP 27


>SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 25 VSNSCSPGDPLVLERPP 41


>SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 15 VSNSCSPGDPLVLERPP 31


>SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 10 VSNSCSPGDPLVLERPP 26


>SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           V NSC+PG PL+LERPP
Sbjct: 59  VSNSCSPGDPLVLERPP 75


>SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 31 VSNSCSPGDPLVLERPP 47


>SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = -1

Query: 80 DNDSLRGLLVPNSCTPGXPLLLERPP 3
          + D  R     NSC+PG PL+LERPP
Sbjct: 18 NEDLARTCFSSNSCSPGDPLVLERPP 43


>SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = -1

Query: 74 DSLRGLLVP-NSCTPGXPLLLERPP 3
          D+L    +P NSC+PG PL+LERPP
Sbjct: 6  DTLISANIPSNSCSPGDPLVLERPP 30


>SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 4  VSNSCSPGDPLVLERPP 20


>SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 41 VSNSCSPGDPLVLERPP 57


>SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 4  VSNSCSPGDPLVLERPP 20


>SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 6  VSNSCSPGDPLVLERPP 22


>SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          ++ NSC+PG PL+LERPP
Sbjct: 5  VISNSCSPGDPLVLERPP 22


>SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          ++  NSC+PG PL+LERPP
Sbjct: 24 IITSNSCSPGDPLVLERPP 42


>SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 15 VSNSCSPGDPLVLERPP 31


>SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8)
          Length = 126

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F  +S R   + NSC+PG PL+LERPP
Sbjct: 24 FSTESPRS--ISNSCSPGDPLVLERPP 48


>SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 399

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L  NSC+PG PL+LERPP
Sbjct: 20 LASNSCSPGDPLVLERPP 37


>SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L  NSC+PG PL+LERPP
Sbjct: 11 LTSNSCSPGDPLVLERPP 28


>SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 240

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = -1

Query: 65  RGLLVPNSCTPGXPLLLERPP 3
           R L + NSC+PG PL+LERPP
Sbjct: 112 RLLGISNSCSPGDPLVLERPP 132


>SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 30 VSNSCSPGDPLVLERPP 46


>SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = -1

Query: 98  NLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           N++ +    SL      NSC+PG PL+LERPP
Sbjct: 12  NISPILPPLSLSRYAGSNSCSPGDPLVLERPP 43


>SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 17 VSNSCSPGDPLVLERPP 33


>SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 34 VSNSCSPGDPLVLERPP 50


>SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 3/25 (12%)
 Frame = -1

Query: 68  LRGLLVP---NSCTPGXPLLLERPP 3
           LR L  P   NSC+PG PL+LERPP
Sbjct: 56  LRSLYFPETSNSCSPGDPLVLERPP 80


>SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          ++ NSC+PG PL+LERPP
Sbjct: 17 VISNSCSPGDPLVLERPP 34


>SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15)
          Length = 802

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59  LLVPNSCTPGXPLLLERPP 3
           + + NSC+PG PL+LERPP
Sbjct: 88  MTISNSCSPGDPLVLERPP 106


>SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 8  VSNSCSPGDPLVLERPP 24


>SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 10 VSNSCSPGDPLVLERPP 26


>SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 23 VSNSCSPGDPLVLERPP 39


>SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 18 VSNSCSPGDPLVLERPP 34


>SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L  NSC+PG PL+LERPP
Sbjct: 11 LASNSCSPGDPLVLERPP 28


>SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L  NSC+PG PL+LERPP
Sbjct: 3  LASNSCSPGDPLVLERPP 20


>SB_12453| Best HMM Match : DUF765 (HMM E-Value=5)
          Length = 140

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L  NSC+PG PL+LERPP
Sbjct: 15 LTSNSCSPGDPLVLERPP 32


>SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -1

Query: 107 KLGNLTTVFDNDSLRGLLVPNSCTPGXPLLLERPP 3
           K+   TT   N   RG    NSC+PG PL+LERPP
Sbjct: 48  KITRKTTRMRNRITRG--GSNSCSPGDPLVLERPP 80


>SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38)
          Length = 1101

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           L  NSC+PG PL+LERPP
Sbjct: 661 LASNSCSPGDPLVLERPP 678


>SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09)
          Length = 781

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = -1

Query: 110 FKLGNLTTVFDNDSLRGLLVP-NSCTPGXPLLLERPP 3
           ++LG   +    +S+     P NSC+PG PL+LERPP
Sbjct: 495 WRLGESGSASARESVPSSSTPSNSCSPGDPLVLERPP 531


>SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 27 VSNSCSPGDPLVLERPP 43


>SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L  NSC+PG PL+LERPP
Sbjct: 7  LASNSCSPGDPLVLERPP 24


>SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5)
          Length = 317

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           V NSC+PG PL+LERPP
Sbjct: 193 VSNSCSPGDPLVLERPP 209


>SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12)
          Length = 716

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = -1

Query: 74  DSLRGLLVPNSCTPGXPLLLERPP 3
           + L  ++  NSC+PG PL+LERPP
Sbjct: 260 EELEEIVGSNSCSPGDPLVLERPP 283


>SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 17 VSNSCSPGDPLVLERPP 33


>SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          L  NSC+PG PL+LERPP
Sbjct: 11 LTSNSCSPGDPLVLERPP 28


>SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L + NSC+PG PL+LERPP
Sbjct: 16 LALSNSCSPGDPLVLERPP 34


>SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = -1

Query: 74 DSLRGLLVP-NSCTPGXPLLLERPP 3
          D+L    +P NSC+PG PL+LERPP
Sbjct: 6  DTLISANIPSNSCSPGDPLVLERPP 30


>SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 34.3 bits (75), Expect = 0.040
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          V NSC+PG PL+LERPP
Sbjct: 10 VSNSCSPGDPLVLERPP 26


>SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F +  +   +  NSC+PG PL+LERPP
Sbjct: 4  FTDTLISANIASNSCSPGDPLVLERPP 30


>SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)
          Length = 129

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 5  ISNSCSPGDPLVLERPP 21


>SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +L  NSC+PG PL+LERPP
Sbjct: 1  MLRSNSCSPGDPLVLERPP 19


>SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L   NSC+PG PL+LERPP
Sbjct: 28 LTASNSCSPGDPLVLERPP 46


>SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)
          Length = 385

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           + NSC+PG PL+LERPP
Sbjct: 261 ISNSCSPGDPLVLERPP 277


>SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 16 ISNSCSPGDPLVLERPP 32


>SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F   +    L  NSC+PG PL+LERPP
Sbjct: 14 FTGHAKNDALSSNSCSPGDPLVLERPP 40


>SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 21 ISNSCSPGDPLVLERPP 37


>SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 17 ISNSCSPGEPLVLERPP 33


>SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          + + NSC+PG PL+LERPP
Sbjct: 13 IFLSNSCSPGDPLVLERPP 31


>SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           + NSC+PG PL+LERPP
Sbjct: 59  ISNSCSPGDPLVLERPP 75


>SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1010

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = -1

Query: 65  RGLLVPNSCTPGXPLLLERPP 3
           R  +  NSC+PG PL+LERPP
Sbjct: 79  RQQMASNSCSPGDPLVLERPP 99


>SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          ++  NSC+PG PL+LERPP
Sbjct: 10 IVTSNSCSPGDPLVLERPP 28


>SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6)
          Length = 174

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59  LLVPNSCTPGXPLLLERPP 3
           + + NSC+PG PL+LERPP
Sbjct: 48  IFLSNSCSPGDPLVLERPP 66


>SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 10 ISNSCSPGDPLVLERPP 26


>SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 3  ISNSCSPGDPLVLERPP 19


>SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 2/21 (9%)
 Frame = -1

Query: 59 LLVP--NSCTPGXPLLLERPP 3
          LL P  NSC+PG PL+LERPP
Sbjct: 17 LLAPTSNSCSPGDPLVLERPP 37


>SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4)
          Length = 180

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           ++ NSC+PG PL+LERPP
Sbjct: 55  ILSNSCSPGDPLVLERPP 72


>SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18)
          Length = 258

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 15/24 (62%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
 Frame = -1

Query: 71  SLRGLLV-PNSCTPGXPLLLERPP 3
           +LR  +V  NSC+PG PL+LERPP
Sbjct: 127 NLRARIVGSNSCSPGDPLVLERPP 150


>SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 13 ISNSCSPGDPLVLERPP 29


>SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 4  ISNSCSPGDPLVLERPP 20


>SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3)
          Length = 176

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           + NSC+PG PL+LERPP
Sbjct: 52  ISNSCSPGDPLVLERPP 68


>SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           + NSC+PG PL+LERPP
Sbjct: 51  ISNSCSPGDPLVLERPP 67


>SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 194

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = -1

Query: 80  DNDSLRGLLVPNSCTPGXPLLLERPP 3
           + ++ RG    NSC+PG PL+LERPP
Sbjct: 61  EGNTNRGKGGSNSCSPGDPLVLERPP 86


>SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 16 ISNSCSPGDPLVLERPP 32


>SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = -1

Query: 65  RGLLVPNSCTPGXPLLLERPP 3
           R +   NSC+PG PL+LERPP
Sbjct: 76  REVATSNSCSPGDPLVLERPP 96


>SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          ++  NSC+PG PL+LERPP
Sbjct: 2  VITSNSCSPGDPLVLERPP 20


>SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L + NSC+PG PL+LERPP
Sbjct: 2  LSLSNSCSPGDPLVLERPP 20


>SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 21 ISNSCSPGDPLVLERPP 37


>SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 276

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           + NSC+PG PL+LERPP
Sbjct: 152 ISNSCSPGDPLVLERPP 168


>SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 4  ISNSCSPGDPLVLERPP 20


>SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          + + NSC+PG PL+LERPP
Sbjct: 33 IFLSNSCSPGDPLVLERPP 51


>SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L   NSC+PG PL+LERPP
Sbjct: 4  LTASNSCSPGDPLVLERPP 22


>SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9)
          Length = 147

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L   NSC+PG PL+LERPP
Sbjct: 21 LTTSNSCSPGDPLVLERPP 39


>SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 7  ISNSCSPGDPLVLERPP 23


>SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12)
          Length = 923

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 3/38 (7%)
 Frame = -1

Query: 107 KLGNLTTVFDNDSLRGLLVP---NSCTPGXPLLLERPP 3
           K+  +  ++    LR +LV    NSC+PG PL+LERPP
Sbjct: 778 KIALMGLIYRKIFLRVMLVAISSNSCSPGDPLVLERPP 815


>SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 4  ISNSCSPGDPLVLERPP 20


>SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          +L  NSC+PG PL+LERPP
Sbjct: 17 ILGSNSCSPGDPLVLERPP 35


>SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = -1

Query: 80 DNDSLRGLLVPNSCTPGXPLLLERPP 3
          D D+ R L   NSC+PG PL+LERPP
Sbjct: 16 DRDTDRHL--SNSCSPGDPLVLERPP 39


>SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -1

Query: 83 FDNDSLRGLLVPNSCTPGXPLLLERPP 3
          F +  +   +  NSC+PG PL+LERPP
Sbjct: 4  FTDTLISANITSNSCSPGDPLVLERPP 30


>SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 18 ISNSCSPGDPLVLERPP 34


>SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 32 ISNSCSPGDPLVLERPP 48


>SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2870

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = -1

Query: 80   DNDSLRGLLVPNSCTPGXPLLLERPP 3
            D       +  NSC+PG PL+LERPP
Sbjct: 2413 DTGGSSSAIASNSCSPGDPLVLERPP 2438


>SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 1/21 (4%)
 Frame = -1

Query: 62 GLLVP-NSCTPGXPLLLERPP 3
          G L P NSC+PG PL+LERPP
Sbjct: 3  GKLEPSNSCSPGDPLVLERPP 23


>SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = -1

Query: 71 SLRGLLVPNSCTPGXPLLLERPP 3
          S++     NSC+PG PL+LERPP
Sbjct: 7  SIKQQATSNSCSPGDPLVLERPP 29


>SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11)
          Length = 1098

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53   VPNSCTPGXPLLLERPP 3
            + NSC+PG PL+LERPP
Sbjct: 974  ISNSCSPGDPLVLERPP 990


>SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 6  ISNSCSPGDPLVLERPP 22


>SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          L   NSC+PG PL+LERPP
Sbjct: 17 LTASNSCSPGDPLVLERPP 35


>SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -1

Query: 83  FDNDSLRGLLVPNSCTPGXPLLLERPP 3
           +  + L    + NSC+PG PL+LERPP
Sbjct: 51  YGGEILAAFELSNSCSPGDPLVLERPP 77


>SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 14/21 (66%), Positives = 16/21 (76%)
 Frame = -1

Query: 65 RGLLVPNSCTPGXPLLLERPP 3
          R L   NSC+PG PL+LERPP
Sbjct: 12 RHLTGSNSCSPGDPLVLERPP 32


>SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 1  ISNSCSPGDPLVLERPP 17


>SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 5  ISNSCSPGDPLVLERPP 21


>SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          ++  NSC+PG PL+LERPP
Sbjct: 9  VITSNSCSPGDPLVLERPP 27


>SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 62 GLLVPNSCTPGXPLLLERPP 3
          G+   NSC+PG PL+LERPP
Sbjct: 28 GVTGSNSCSPGDPLVLERPP 47


>SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 2  ISNSCSPGDPLVLERPP 18


>SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 2  ISNSCSPGDPLVLERPP 18


>SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 14 ISNSCSPGDPLVLERPP 30


>SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 2  ISNSCSPGDPLVLERPP 18


>SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 8  ISNSCSPGDPLVLERPP 24


>SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7)
          Length = 176

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           + NSC+PG PL+LERPP
Sbjct: 52  ISNSCSPGDPLVLERPP 68


>SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = -1

Query: 59  LLVPNSCTPGXPLLLERPP 3
           L+  NSC+PG PL+LERPP
Sbjct: 53  LMRSNSCSPGDPLVLERPP 71


>SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 229

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56  LVPNSCTPGXPLLLERPP 3
           ++ NSC+PG PL+LERPP
Sbjct: 104 ILSNSCSPGDPLVLERPP 121


>SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 7  ISNSCSPGDPLVLERPP 23


>SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = -1

Query: 56 LVPNSCTPGXPLLLERPP 3
          ++ NSC+PG PL+LERPP
Sbjct: 12 ILSNSCSPGDPLVLERPP 29


>SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 6  ISNSCSPGDPLVLERPP 22


>SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -1

Query: 59 LLVPNSCTPGXPLLLERPP 3
          ++  NSC+PG PL+LERPP
Sbjct: 11 IVASNSCSPGDPLVLERPP 29


>SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 30 ISNSCSPGDPLVLERPP 46


>SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 170

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 46 ISNSCSPGDPLVLERPP 62


>SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53 VPNSCTPGXPLLLERPP 3
          + NSC+PG PL+LERPP
Sbjct: 45 ISNSCSPGDPLVLERPP 61


>SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1295

 Score = 33.9 bits (74), Expect = 0.053
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 53  VPNSCTPGXPLLLERPP 3
           + NSC+PG PL+LERPP
Sbjct: 591 ISNSCSPGDPLVLERPP 607


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,221,184
Number of Sequences: 59808
Number of extensions: 162175
Number of successful extensions: 2374
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 2352
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2374
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 764823134
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -