SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30074.Seq
         (450 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08)                   31   0.58 
SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05)         31   0.58 
SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_43689| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.58 
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.77 
SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.77 
SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.77 
SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.77 
SB_2190| Best HMM Match : SGS (HMM E-Value=2.5)                        30   1.0  
SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.3  
SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   1.8  
SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.3  
SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.3  
SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59)                   28   3.1  
SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.1  
SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   3.1  
SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.1  
SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.1  
SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.1  
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.4  
SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.4  
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2)                    27   7.2  
SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_51199| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8)             27   7.2  
SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   7.2  
SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   7.2  
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               27   9.5  
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14)           27   9.5  
SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15)                27   9.5  
SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  
SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6)               27   9.5  
SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  
SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.5  

>SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08)
          Length = 993

 Score = 30.7 bits (66), Expect = 0.58
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +2

Query: 254 GTGYCIYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYY 406
           G G C+Y       S +++C    +  S  AVC+++   H  RP F+S  Y
Sbjct: 523 GGGVCLYLR-----SSINYCIRNLVPDSVEAVCVEITKPH-SRPFFVSIIY 567


>SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05)
          Length = 670

 Score = 30.7 bits (66), Expect = 0.58
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +2

Query: 254 GTGYCIYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYY 406
           G G C+Y       S +++C    +  S  AVC+++   H  RP F+S  Y
Sbjct: 404 GGGVCLYLR-----SSINYCIRNLVPDSVEAVCVEITKPH-SRPFFVSIIY 448


>SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 30.7 bits (66), Expect = 0.58
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = -3

Query: 112 FKLGNLTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8
           F+ G+LTT      +R  L+   C+PG PL LERP
Sbjct: 7   FRCGHLTTNAAT-RVRFPLISNSCSPGDPLVLERP 40


>SB_43689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 416

 Score = 30.7 bits (66), Expect = 0.58
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 269 IYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYR-RPLFISTYYAS 412
           + F A+++C +LH    IF     L VC++L   +Y+ R +F+  Y  S
Sbjct: 137 VEFKAMIICLILHLLLLIF----ELLVCINLGGRNYQWRIMFMPLYVLS 181


>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 30.3 bits (65), Expect = 0.77
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -3

Query: 79 NDSLRGLLVPXXCTPGXPLXLERP 8
          N + R  LV   C+PG PL LERP
Sbjct: 17 NPNTRAHLVSNSCSPGDPLVLERP 40


>SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 30.3 bits (65), Expect = 0.77
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = -3

Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8
          ++ D+L   L    C+PG PL LERP
Sbjct: 6  YETDALPTALTSNSCSPGDPLVLERP 31


>SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 30.3 bits (65), Expect = 0.77
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 3/35 (8%)
 Frame = -3

Query: 103 GNLTTVFDNDSLRGL---LVPXXCTPGXPLXLERP 8
           GNL  VF  D +R L   L+   C+PG PL LERP
Sbjct: 20  GNLDDVFVRD-IRILFLDLISNSCSPGDPLVLERP 53


>SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 30.3 bits (65), Expect = 0.77
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = -3

Query: 100 NLTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8
           N+ T +   S R  LV   C+PG PL LERP
Sbjct: 12  NIPTRYAILSPRARLVSNSCSPGDPLVLERP 42


>SB_2190| Best HMM Match : SGS (HMM E-Value=2.5)
          Length = 221

 Score = 29.9 bits (64), Expect = 1.0
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = -3

Query: 91  TVFDNDSLRGLLVPXXCTPGXPLXLERP 8
           +++ ++ ++  L    C+PG PL LERP
Sbjct: 85  SIYGHEDIKRALASNSCSPGDPLVLERP 112


>SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 29.5 bits (63), Expect = 1.3
 Identities = 12/20 (60%), Positives = 14/20 (70%)
 Frame = -3

Query: 67 RGLLVPXXCTPGXPLXLERP 8
          R +LV   C+PG PL LERP
Sbjct: 23 RPMLVSNSCSPGDPLVLERP 42


>SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 29.1 bits (62), Expect = 1.8
 Identities = 12/18 (66%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          LLV   C+PG PL LERP
Sbjct: 16 LLVSNSCSPGDPLVLERP 33


>SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 29.1 bits (62), Expect = 1.8
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -3

Query: 73 SLRGLLVPXXCTPGXPLXLERP 8
          +L  L++   C+PG PL LERP
Sbjct: 21 TLGSLIISNSCSPGDPLVLERP 42


>SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 28.7 bits (61), Expect = 2.3
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = -3

Query: 79 NDSLRGLLVPXXCTPGXPLXLERP 8
          +++LR +LV   C+PG PL LERP
Sbjct: 3  HNTLR-ILVSNSCSPGDPLVLERP 25


>SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 28.7 bits (61), Expect = 2.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = -3

Query: 79 NDSLRGLLVPXXCTPGXPLXLERP 8
          N  +RG      C+PG PL LERP
Sbjct: 11 NPEVRGSKPSNSCSPGDPLVLERP 34


>SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59)
          Length = 160

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +3

Query: 9  GRSRXSGXPGVQXXGTRRPLRESLSKTV 92
          GRSR SG PG+Q    +R  R  L + +
Sbjct: 10 GRSRTSGSPGLQEFDNKRAARRDLDQFI 37


>SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 447

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%)
 Frame = -3

Query: 76  DSLRG-LLVPXXCTPGXPLXLERP 8
           D  +G LL    C+PG PL LERP
Sbjct: 71  DECKGILLTSNSCSPGDPLVLERP 94


>SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = -3

Query: 88  VFDNDSLRGLLVPXXCTPGXPLXLERP 8
           VF ++S     V   C+PG PL LERP
Sbjct: 21  VFYSNSTPHFRVSNSCSPGDPLVLERP 47


>SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +LV   C+PG PL LERP
Sbjct: 4  MLVSNSCSPGDPLVLERP 21


>SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +LV   C+PG PL LERP
Sbjct: 1  MLVSNSCSPGDPLVLERP 18


>SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%)
 Frame = -3

Query: 94 TTVFDNDSLRGLLVPXX-CTPGXPLXLERP 8
          T +  N  LRG+      C+PG PL LERP
Sbjct: 7  TLISANIRLRGICAASNSCSPGDPLVLERP 36


>SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.9 bits (59), Expect = 4.1
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -3

Query: 67 RGLLVPXXCTPGXPLXLERP 8
          RG+     C+PG PL LERP
Sbjct: 30 RGVHASNSCSPGDPLVLERP 49


>SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 213

 Score = 27.9 bits (59), Expect = 4.1
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 76  DSLRGLLVPXXCTPGXPLXLERP 8
           D+   LL    C+PG PL LERP
Sbjct: 82  DASNLLLTSNSCSPGDPLVLERP 104


>SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 27.9 bits (59), Expect = 4.1
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = -3

Query: 73 SLRGLLVPXXCTPGXPLXLERP 8
          +L   L+   C+PG PL LERP
Sbjct: 2  ALSSFLLSNSCSPGDPLVLERP 23


>SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -3

Query: 70 LRGLLVPXXCTPGXPLXLERP 8
          L   L+   C+PG PL LERP
Sbjct: 13 LISFLISNSCSPGDPLVLERP 33


>SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          L V   C+PG PL LERP
Sbjct: 8  LFVSNSCSPGDPLVLERP 25


>SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/17 (64%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          LV   C+PG PL LERP
Sbjct: 3  LVSNSCSPGDPLVLERP 19


>SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = -3

Query: 70 LRGLLVPXXCTPGXPLXLERP 8
          L+ L+    C+PG PL LERP
Sbjct: 16 LKLLITSNSCSPGDPLVLERP 36


>SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = -3

Query: 67 RGLLVPXXCTPGXPLXLERP 8
          R L +   C+PG PL LERP
Sbjct: 4  RRLFLSNSCSPGDPLVLERP 23


>SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 1/20 (5%)
 Frame = -3

Query: 64 GLLVPXX-CTPGXPLXLERP 8
          GL +P   C+PG PL LERP
Sbjct: 4  GLFLPSNSCSPGDPLVLERP 23


>SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/19 (57%), Positives = 12/19 (63%)
 Frame = -3

Query: 64 GLLVPXXCTPGXPLXLERP 8
          G  V   C+PG PL LERP
Sbjct: 31 GFKVSNSCSPGDPLVLERP 49


>SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          LL    C+PG PL LERP
Sbjct: 4  LLASNSCSPGDPLVLERP 21


>SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = -3

Query: 70 LRGLLVPXXCTPGXPLXLERP 8
          +R  L+   C+PG PL LERP
Sbjct: 4  VRIYLISNSCSPGDPLVLERP 24


>SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -3

Query: 88  VFDNDSLRGLLVPXXCTPGXPLXLERP 8
           V D D+L        C+PG PL LERP
Sbjct: 31  VLDLDALDTTQGSNSCSPGDPLVLERP 57


>SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -3

Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8
          F+N   R   V   C+PG PL LERP
Sbjct: 5  FENRIGRCWQVSNSCSPGDPLVLERP 30


>SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = -3

Query: 70 LRGLLVPXXCTPGXPLXLERP 8
          LR L     C+PG PL LERP
Sbjct: 31 LRKLCESNSCSPGDPLVLERP 51


>SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = -3

Query: 109 KLGNLTTVFDNDSLR-GLLVPXXCTPGXPLXLERP 8
           KL  +  V D   L  G  +   C+PG PL LERP
Sbjct: 4   KLTEMCAVRDTSILSAGRSLSNSCSPGDPLVLERP 38


>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = -3

Query: 67  RGLLVPXXCTPGXPLXLERP 8
           + L +   C+PG PL LERP
Sbjct: 97  KSLKISNSCSPGDPLVLERP 116


>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2)
          Length = 558

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -3

Query: 97  LTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8
           +T +   +   G      C+PG PL LERP
Sbjct: 465 VTRLLQGEIASGQTTSNSCSPGDPLVLERP 494


>SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -3

Query: 73  SLRGLLVPXXCTPGXPLXLERP 8
           S +   +   C+PG PL LERP
Sbjct: 41  SKKNFFISNSCSPGDPLVLERP 62


>SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +++   C+PG PL LERP
Sbjct: 13 IIISNSCSPGDPLVLERP 30


>SB_51199| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 16/29 (55%), Positives = 17/29 (58%)
 Frame = -3

Query: 94 TTVFDNDSLRGLLVPXXCTPGXPLXLERP 8
          T  FDN SLR L +     PG PL LERP
Sbjct: 13 TRGFDNKSLR-LKMNYAEIPGDPLVLERP 40


>SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = -3

Query: 82 DNDSLRGLL-VPXXCTPGXPLXLERP 8
          +N SL+    +   C+PG PL LERP
Sbjct: 22 ENSSLKPTFSISNSCSPGDPLVLERP 47


>SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          L V   C+PG PL LERP
Sbjct: 2  LYVSNSCSPGDPLVLERP 19


>SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +L+   C+PG PL LERP
Sbjct: 5  ILLSNSCSPGDPLVLERP 22


>SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8)
          Length = 351

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = -3

Query: 112 FKLGNLTTVFDNDSLRGLLVPXXCTPGXPLXLERP 8
           FK+ N       +  + L     C+PG PL LERP
Sbjct: 208 FKVSNTPAAEQRNYTQLLESSNSCSPGDPLVLERP 242


>SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 40 LISNSCSPGDPLVLERP 56


>SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58  LVPXXCTPGXPLXLERP 8
           L+   C+PG PL LERP
Sbjct: 70  LISNSCSPGDPLVLERP 86


>SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 34 LISNSCSPGDPLVLERP 50


>SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -3

Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8
          F +  +   +V   C+PG PL LERP
Sbjct: 4  FTDTLISANIVSNSCSPGDPLVLERP 29


>SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 21 LISNSCSPGDPLVLERP 37


>SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 16 LISNSCSPGDPLVLERP 32


>SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 33 LISNSCSPGDPLVLERP 49


>SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 27.1 bits (57), Expect = 7.2
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          L+   C+PG PL LERP
Sbjct: 31 LISNSCSPGDPLVLERP 47


>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 3/28 (10%)
 Frame = -3

Query: 82 DNDSLRGLLVPXX---CTPGXPLXLERP 8
          DN +    LVP     C+PG PL LERP
Sbjct: 14 DNGTNGASLVPRPSNSCSPGDPLVLERP 41


>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
          Length = 472

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58  LVPXXCTPGXPLXLERP 8
           +V   C+PG PL LERP
Sbjct: 347 IVSNSCSPGDPLVLERP 363


>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          LL    C+PG PL LERP
Sbjct: 24 LLPSNSCSPGDPLVLERP 41


>SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 164

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          L V   C+PG PL LERP
Sbjct: 38 LRVSNSCSPGDPLVLERP 55


>SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +++   C+PG PL LERP
Sbjct: 13 IVISNSCSPGDPLVLERP 30


>SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 70 LRGLLVPXXCTPGXPLXLERP 8
          +R +     C+PG PL LERP
Sbjct: 3  MRVIFTSNSCSPGDPLVLERP 23


>SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58  LVPXXCTPGXPLXLERP 8
           +V   C+PG PL LERP
Sbjct: 77  IVSNSCSPGDPLVLERP 93


>SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -3

Query: 64 GLLVPXXCTPGXPLXLERP 8
          G+     C+PG PL LERP
Sbjct: 7  GIKTSNSCSPGDPLVLERP 25


>SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = -3

Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8
          F +  +   ++   C+PG PL LERP
Sbjct: 4  FTDTLISANIISNSCSPGDPLVLERP 29


>SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          ++V   C+PG PL LERP
Sbjct: 6  VVVSNSCSPGDPLVLERP 23


>SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          +V   C+PG PL LERP
Sbjct: 11 MVSNSCSPGDPLVLERP 27


>SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -3

Query: 70 LRGLLVPXXCTPGXPLXLERP 8
          +R L     C+PG PL LERP
Sbjct: 24 IRSLQRSNSCSPGDPLVLERP 44


>SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14)
          Length = 190

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = -3

Query: 97  LTTVFDND-SLRGLLVPXXCTPGXPLXLERP 8
           LT V  N  +L   ++   C+PG PL LERP
Sbjct: 51  LTLVITNLLALTVFMLSNSCSPGDPLVLERP 81


>SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          +V   C+PG PL LERP
Sbjct: 1  MVSNSCSPGDPLVLERP 17


>SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +++   C+PG PL LERP
Sbjct: 4  VIISNSCSPGDPLVLERP 21


>SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -3

Query: 64 GLLVPXXCTPGXPLXLERP 8
          G+     C+PG PL LERP
Sbjct: 8  GIRTSNSCSPGDPLVLERP 26


>SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          L V   C+PG PL LERP
Sbjct: 16 LKVSNSCSPGDPLVLERP 33


>SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15)
          Length = 220

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +2

Query: 311 CYYIFISTSSLAVCLDLNNSHYRRPLFISTYY 406
           C+ + ++T +   CL L N HY  P   S +Y
Sbjct: 10  CFSVALATDA-TYCLSLPNGHYHDPRNCSRFY 40


>SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 210

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58  LVPXXCTPGXPLXLERP 8
           +V   C+PG PL LERP
Sbjct: 85  IVSNSCSPGDPLVLERP 101


>SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +L    C+PG PL LERP
Sbjct: 10 MLASNSCSPGDPLVLERP 27


>SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = -3

Query: 82 DN-DSLRGLLVPXXCTPGXPLXLERP 8
          DN +  R L     C+PG PL LERP
Sbjct: 5  DNLEGSRRLQTSNSCSPGDPLVLERP 30


>SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          +V   C+PG PL LERP
Sbjct: 6  IVSNSCSPGDPLVLERP 22


>SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = -3

Query: 58 LVPXXCTPGXPLXLERP 8
          +V   C+PG PL LERP
Sbjct: 1  MVSNSCSPGDPLVLERP 17


>SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          LL    C+PG PL LERP
Sbjct: 21 LLPSNSCSPGDPLVLERP 38


>SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 192

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -3

Query: 82  DNDSLRGLLVPXXCTPGXPLXLERP 8
           D + ++ + +   C+PG PL LERP
Sbjct: 59  DLNIIQKIKISNSCSPGDPLVLERP 83


>SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = -3

Query: 85 FDNDSLRGLLVPXXCTPGXPLXLERP 8
          F +  +   ++   C+PG PL LERP
Sbjct: 4  FTDTLISANIISNSCSPGDPLVLERP 29


>SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          L V   C+PG PL LERP
Sbjct: 7  LRVSNSCSPGDPLVLERP 24


>SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          +++   C+PG PL LERP
Sbjct: 24 IVISNSCSPGDPLVLERP 41


>SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6)
          Length = 270

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -3

Query: 61  LLVPXXCTPGXPLXLERP 8
           L+    C+PG PL LERP
Sbjct: 144 LITSNSCSPGDPLVLERP 161


>SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%)
 Frame = -3

Query: 79 NDSLRGLL-VPXXCTPGXPLXLERP 8
          N S + LL +   C+PG PL LERP
Sbjct: 3  NQSKQCLLEISNSCSPGDPLVLERP 27


>SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -3

Query: 61 LLVPXXCTPGXPLXLERP 8
          L+    C+PG PL LERP
Sbjct: 5  LITSNSCSPGDPLVLERP 22


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,957,648
Number of Sequences: 59808
Number of extensions: 200405
Number of successful extensions: 2441
Number of sequences better than 10.0: 91
Number of HSP's better than 10.0 without gapping: 2414
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2441
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 896151577
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -