SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  

>SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 201

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +1

Query: 445 AAQSFRYRYQYRFPNWIPFHHAKSSFGTSA*LCTYLYTLQGAWSVRLKQWA--AGRAHTI 618
           AAQ   YR  YR P  +P       F   A + T    +Q A S     W   +G+A   
Sbjct: 9   AAQRDAYRTSYRGPPKVPNERKARPFSAKARISTEKVDIQTAESPSRPPWRPFSGQASLS 68

Query: 619 N-S*PTKEGVYT 651
             S P+KE ++T
Sbjct: 69  RVSAPSKETIFT 80


>SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 906

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = -3

Query: 310 LATWEVDTQSXCLSKSPHMTRLS 242
           + TW VD  S C S SPH   L+
Sbjct: 88  IRTWNVDVNSLCCSWSPHAVWLA 110


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,685,303
Number of Sequences: 59808
Number of extensions: 412846
Number of successful extensions: 781
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 713
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 781
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1841633001
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -