SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30044.Seq
         (443 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23864| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.0  
SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.0  
SB_15366| Best HMM Match : rve (HMM E-Value=0.00011)                   27   7.0  
SB_51816| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-24)                 27   7.0  
SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.0  
SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09)                   27   7.0  
SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.2  
SB_25197| Best HMM Match : TatC (HMM E-Value=1.8)                      27   9.2  

>SB_23864| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = +3

Query: 135 FPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLA 266
           + L D K    AKS+  T HN     H +  ++P  +  +PP A
Sbjct: 22  YRLMDVKKFTNAKSRIQTTHNPPHAFHTHPKRRPYSSILQPPFA 65


>SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1383

 Score = 27.9 bits (59), Expect = 4.0
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = +3

Query: 207 KAHRNGIKKPRKTRH 251
           K HRNGIKKPR  R+
Sbjct: 175 KWHRNGIKKPRTNRY 189


>SB_15366| Best HMM Match : rve (HMM E-Value=0.00011)
          Length = 1178

 Score = 27.1 bits (57), Expect = 7.0
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +1

Query: 196 TKTAKLTEMVSKSQGRPGTNHPW 264
           +KT+    M S S  RPG N+PW
Sbjct: 931 SKTSPTLTMRSNSTTRPGKNNPW 953


>SB_51816| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-24)
          Length = 384

 Score = 27.1 bits (57), Expect = 7.0
 Identities = 14/48 (29%), Positives = 22/48 (45%)
 Frame = -1

Query: 323 LASGYPSCKTFDSLKILDPCQGWFVPGLPWLFDTISVSFAVLVMICMI 180
           L  G P         IL    G+FV G  +L+ T  +   V+++IC +
Sbjct: 146 LLPGLPLLALLSDKVILVYFPGFFVCGQEFLYPTGQIELGVIILICTL 193


>SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 451

 Score = 27.1 bits (57), Expect = 7.0
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           +  S    +HN  +   R GIK+PR+++ E
Sbjct: 342 LTTSPTMISHNNQQNDSRRGIKRPRRSQEE 371


>SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09)
          Length = 1103

 Score = 27.1 bits (57), Expect = 7.0
 Identities = 14/43 (32%), Positives = 20/43 (46%)
 Frame = +3

Query: 129 LYFPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEP 257
           L  P++D K  K    K+H  H  ++KAH +    P    H P
Sbjct: 239 LVTPIKDKK--KPHHKKHHHKHRHHKKAHHSDPAVPPPIEHRP 279


>SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 26.6 bits (56), Expect = 9.2
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +3

Query: 333 SRGRLREKLPEKQRPRNE 386
           SRGR  EK PEKQR +++
Sbjct: 267 SRGRSAEKSPEKQRDKSD 284


>SB_25197| Best HMM Match : TatC (HMM E-Value=1.8)
          Length = 622

 Score = 26.6 bits (56), Expect = 9.2
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = +3

Query: 156 LIKMAKSKNHTNHNQNRKAH-RNGIKKPRKTRHEPPLA 266
           LI   KSK+H NHN+  + H  + I K     H+  +A
Sbjct: 571 LIVYCKSKHHANHNKGCERHFEDDINKCGCRNHDHTIA 608


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,059,527
Number of Sequences: 59808
Number of extensions: 188102
Number of successful extensions: 496
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 471
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 495
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 871599479
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -