SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_3347| Best HMM Match : WD40 (HMM E-Value=0.053)                     37   0.023
SB_9416| Best HMM Match : WD40 (HMM E-Value=0)                         36   0.030
SB_49036| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.070
SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.86 
SB_39704| Best HMM Match : 7tm_2 (HMM E-Value=7e-12)                   31   1.1  
SB_855| Best HMM Match : 7tm_2 (HMM E-Value=5.4e-12)                   30   2.0  
SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22)                  29   6.1  
SB_5797| Best HMM Match : PH (HMM E-Value=3.7e-37)                     28   8.0  

>SB_3347| Best HMM Match : WD40 (HMM E-Value=0.053)
          Length = 321

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = +1

Query: 298 SAKVTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTYNISIENNTK 438
           S+KV  ++WSR   LYSC+ D  + EW  E    K+   I +E   K
Sbjct: 67  SSKVNDVEWSRNGELYSCSSDKYIVEWCTEKAEHKR--YIELETKAK 111


>SB_9416| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 700

 Score = 36.3 bits (80), Expect = 0.030
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 289 KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQTYNISIENNT 435
           K   + + AL + +  G LYS  +DS +  WN+ +  +K  Y +S+E++T
Sbjct: 27  KRHRSGINALQYDKSNGRLYSAGRDSIIRCWNVRNERIKDPYMVSLEHHT 76


>SB_49036| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 696

 Score = 35.1 bits (77), Expect = 0.070
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 5/53 (9%)
 Frame = +1

Query: 277 WVPAK--HFSAKVTALDWS---RKYGLYSCTKDSRVYEWNIEDGSVKQTYNIS 420
           W P++   +S+KV +L WS    +Y L++C  D     W I   S  QT++++
Sbjct: 301 WKPSEVQAYSSKVLSLLWSLGQHQYNLFTCGPDGNTMWWRIRPDSTDQTFHLA 353


>SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3066

 Score = 31.5 bits (68), Expect = 0.86
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +1

Query: 421  IENNTKQGSHINAIKIIPHNPAPAIPVLST 510
            +E  +KQ  H+N +K+I HN  P IPV +T
Sbjct: 1241 LETVSKQ-LHVNLVKVIVHNCCPPIPVANT 1269


>SB_39704| Best HMM Match : 7tm_2 (HMM E-Value=7e-12)
          Length = 873

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 12/45 (26%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +1

Query: 352 TKDSRVYEWNIEDGSVKQTYNISIENNTKQGSHINAIKIIP-HNP 483
           +K   +  WN E+ S+   +++S  NN+K G+ +    +   H P
Sbjct: 381 SKSIEIVSWNFEEWSIAVVFDVSAVNNSKNGTSLKKSPLFQFHEP 425


>SB_855| Best HMM Match : 7tm_2 (HMM E-Value=5.4e-12)
          Length = 701

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = -1

Query: 489 WCWIVWYNFYGVYMAPLLRIIFNRNIIGLF 400
           +CW+    FYG ++AP+L ++    ++ +F
Sbjct: 456 FCWMQQDAFYGAFLAPVLLLVVGNTVVFVF 485


>SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22)
          Length = 874

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +1

Query: 289 KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNI 384
           K  + KV  + WS+    + SC  D  VYEWN+
Sbjct: 271 KGHNGKVRQVIWSQDDSKIISCGMDGAVYEWNV 303


>SB_5797| Best HMM Match : PH (HMM E-Value=3.7e-37)
          Length = 1481

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +1

Query: 310 TALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTYNISIENNTKQGSHINAIKIIPHN 480
           T   ++ +Y L S   ++  Y  NI   +   TYN++   N+ + S+I+     P N
Sbjct: 287 TYSSYNNRYNLNSYNNNNNTY--NINTYNNNNTYNVNSYKNSNKNSYISTSDSYPKN 341


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,497,717
Number of Sequences: 59808
Number of extensions: 431531
Number of successful extensions: 894
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 724
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 890
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2311562737
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -