SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041)         48   5e-06
SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0)                29   2.3  
SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_25763| Best HMM Match : MgtE_N (HMM E-Value=1.9)                    29   3.1  
SB_8793| Best HMM Match : C1_1 (HMM E-Value=0.21)                      29   4.1  
SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05)              28   7.1  

>SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041)
          Length = 50

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 29/55 (52%), Positives = 34/55 (61%), Gaps = 4/55 (7%)
 Frame = +3

Query: 333 MRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA----PSPSFKFPGRAK 485
           MR AFGKPQGTVARV IGQ I+S+R        G++ +A        FKFPGR K
Sbjct: 1   MRGAFGKPQGTVARVNIGQTIISIR-----TKDGNKAAAIEALRRAKFKFPGRQK 50


>SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0)
          Length = 1219

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +3

Query: 423 EGTGHRGSAPSPSFKFPGRAKDLRIKEVGFTK-YERDEFXKLA*XGP 560
           +G  +RGS P P+   P +AK +RI  VG  + + R E  ++A   P
Sbjct: 432 DGKTNRGSKPYPTVLAPLQAKGVRIVAVGIGQGFTRRELLEIALGNP 478


>SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 698

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = -1

Query: 187 PKPLSSAVHIRRTPSARTVESRQRSLXSYPNRRYGSWDQ 71
           PK  SS V+  RT  AR    ++R++  Y  ++YG W Q
Sbjct: 295 PKFFSSIVYYGRT--ARFDYGKRRNMKRYGKKKYGKWRQ 331


>SB_25763| Best HMM Match : MgtE_N (HMM E-Value=1.9)
          Length = 483

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/59 (25%), Positives = 25/59 (42%)
 Frame = +2

Query: 326 DWDAXCVWQASGYCSTCSHWTXHHVRAALVTGGRHRSSRXCAVAKFQVPRTCKRSTYQR 502
           +W A   W A    +T  +W+ +H  A+  T      +  CA    +   TC+   Y+R
Sbjct: 423 NWSAHNNWSAHNNWNTYHNWSTYHTGASTTTERATTPTPGCACYDNET-MTCRSVRYER 480


>SB_8793| Best HMM Match : C1_1 (HMM E-Value=0.21)
          Length = 260

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 19/55 (34%), Positives = 26/55 (47%)
 Frame = +1

Query: 241 QFHIR*DFTLSTLSASIKCYHALELIXSRLGCVVRLASLRVL*HVFALDXXSCPC 405
           +FH+R  F L  LS S   Y     +   L C +R  +L +L  + AL   SC C
Sbjct: 183 RFHVRCAFLLVALSCSSCFYVHCAFVLVALSCSLRFCALALLCLLVAL---SCSC 234


>SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05)
          Length = 726

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 9/20 (45%), Positives = 10/20 (50%)
 Frame = +2

Query: 341 CVWQASGYCSTCSHWTXHHV 400
           C W  +G C  C HW   HV
Sbjct: 79  CYWIRTGCCHLCWHWRPLHV 98


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,030,197
Number of Sequences: 59808
Number of extensions: 351483
Number of successful extensions: 695
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 666
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 695
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1560464625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -