SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_46036| Best HMM Match : PSRT (HMM E-Value=1)                        30   1.4  
SB_24251| Best HMM Match : ubiquitin (HMM E-Value=0.1)                 30   1.9  
SB_21821| Best HMM Match : MRG (HMM E-Value=0)                         29   2.5  
SB_17045| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.5  
SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28)                 29   4.4  
SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.4  
SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31)        28   5.8  
SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.8  
SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.8  
SB_43574| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.8  
SB_38061| Best HMM Match : DUF995 (HMM E-Value=4)                      28   7.7  
SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.7  
SB_6548| Best HMM Match : Helicase_C (HMM E-Value=0.003)               28   7.7  
SB_4355| Best HMM Match : DUF1421 (HMM E-Value=6.6)                    28   7.7  

>SB_46036| Best HMM Match : PSRT (HMM E-Value=1)
          Length = 878

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +1

Query: 385 VMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLP------TKRKRIRLNPV 546
           + VPR+SS    H+E+    R I+P  E + +S   E+ +  P      TK+K  +    
Sbjct: 771 IEVPRRSS----HMEDSSANRSISPVKE-RASSKPSEKAMEAPSGKAPDTKQKERKKTDS 825

Query: 547 DSDDSDVENKADN 585
           DSDD D  +++D+
Sbjct: 826 DSDD-DESSESDS 837


>SB_24251| Best HMM Match : ubiquitin (HMM E-Value=0.1)
          Length = 275

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
 Frame = +1

Query: 388 MVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVI--SLPTKRKRIRLNPVDSDDS 561
           M  +   + G++L+ +KR +      +L   S D +  +  S+PT +  I ++  DSDDS
Sbjct: 1   MSRKTGPRSGVNLQAEKRRKVEESDDDLDLFSFDNQIPLTFSVPTSQTAISID--DSDDS 58

Query: 562 DVE 570
           DV+
Sbjct: 59  DVD 61


>SB_21821| Best HMM Match : MRG (HMM E-Value=0)
          Length = 292

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 5/69 (7%)
 Frame = +1

Query: 400 KSSKKGIHLENKKRERQITPSPELKKAS-SDEE----EVISLPTKRKRIRLNPVDSDDSD 564
           K +   +  + + RE+ +      KK   SD E    E ++ PT+RKR RLN    +D +
Sbjct: 60  KYNDANLQKQRELREQNLKSKKARKKQEKSDSEKTKLEEVAGPTRRKRTRLNNTLDNDEN 119

Query: 565 VENKADNKI 591
              + D KI
Sbjct: 120 YVPRVDVKI 128


>SB_17045| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1146

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +3

Query: 309 TLFNYFTKTPPTNKKLKADATEDTDCNGSPKKQ*KRNTS*KQ-KT-RKAN 452
           TLF+YFTK  P NK   A    +T+   SPK + K   + K+ KT  KAN
Sbjct: 3   TLFSYFTKV-PANKSPNAGDRPETNGKTSPKGKAKTPETKKEVKTSTKAN 51


>SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28)
          Length = 440

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +1

Query: 433 KKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           K R R  + SP  KKA S +    SL   +KR   +P+   +S+ +  + ++
Sbjct: 369 KSRSRSHSNSPSRKKARSKKSRSRSLSKSKKRRSRSPITKKESNSKRHSHSR 420


>SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 752

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPE-LKKASSDEEEVISLPTKRKRIRLNPVDSD 555
           PR++ +        KR R+ T   E ++K+  + E+V   PT+ +R+R +P +S+
Sbjct: 267 PREAERGRESPRESKRVREGTREAERVRKSPKESEKVREGPTESERVRESPRESE 321


>SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31)
          Length = 2122

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 13/51 (25%), Positives = 28/51 (54%)
 Frame = +3

Query: 300  AANTLFNYFTKTPPTNKKLKADATEDTDCNGSPKKQ*KRNTS*KQKTRKAN 452
            ++ T  N  ++TPP ++K++AD   + +   SP    KR  + ++++   N
Sbjct: 2066 SSRTSSNRDSRTPPADEKIRADINSN-EVQSSPSPSTKREEARRERSNARN 2115


>SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1109

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 20/78 (25%), Positives = 37/78 (47%)
 Frame = +1

Query: 331 KHRQRIKN*KRTLLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISL 510
           + R+R K    +L K+ +V    K    G     KK + + TP PE++K  ++ E ++  
Sbjct: 475 RDRKRGKE-SESLSKVAVVKPKEKRDCSG-----KKDQSETTPDPEIQK-QNEVESLVLT 527

Query: 511 PTKRKRIRLNPVDSDDSD 564
             +RK+     VD +  +
Sbjct: 528 ELERKQFNTEVVDVESEE 545


>SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 936

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 14/28 (50%), Positives = 21/28 (75%)
 Frame = +1

Query: 160 NENESQMVYHKKVNFCPVISKNKNLIQQ 243
           N+ +SQ+V   K NF PV ++++NLIQQ
Sbjct: 72  NKRKSQIV---KENFWPVTARSRNLIQQ 96


>SB_43574| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 100

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = -3

Query: 231 IFIFTYYRAKVYFLMI--YHLTFIFILLSQKST*VKIILITEHY 106
           I +   Y   +  ++I  YH+T I IL++     + IILI  H+
Sbjct: 16  IILIAPYHITIIIILIASYHITIIIILIASYHITIIIILIASHH 59


>SB_38061| Best HMM Match : DUF995 (HMM E-Value=4)
          Length = 220

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPEL-KKASSDEEEVISLPTKRKRIRLNPVDSDDSDVEN 573
           RK +K+   L  KK+ + +    E  +K   D + +  L  KRK  +   + ++D+D +N
Sbjct: 152 RKLNKR---LRQKKKNKNVANGEENERKVKGDNKGLKKLKKKRKGGKNQKMPNEDADSKN 208

Query: 574 KADNKI 591
            A N +
Sbjct: 209 IASNSL 214


>SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2248

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 9/42 (21%), Positives = 26/42 (61%)
 Frame = +1

Query: 376 IPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEV 501
           +P+V  P +  ++  + +++++ +Q+T S ++  A  + +EV
Sbjct: 679 VPLVRTPSEDQERATNADSQQQWKQVTTSSDVNNALDELDEV 720


>SB_6548| Best HMM Match : Helicase_C (HMM E-Value=0.003)
          Length = 1063

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR 528
           P +S ++   L +K+R     P P++   S DE E  S P+ R++
Sbjct: 626 PARSPRRK-SLRHKRRSISQRPCPDIVDDSDDESETTSRPSSRQQ 669


>SB_4355| Best HMM Match : DUF1421 (HMM E-Value=6.6)
          Length = 642

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +1

Query: 394 PRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR 528
           P +S ++   L +K+R     P P++   S DE E  S P+ R++
Sbjct: 481 PARSPRRK-SLRHKRRSISQRPCPDIVDDSDDESETTSRPSSRQQ 524


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,676,515
Number of Sequences: 59808
Number of extensions: 295971
Number of successful extensions: 1175
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1051
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1164
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1681430875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -