SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031)           30   1.8  
SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.)              25   3.5  
SB_20327| Best HMM Match : LIM (HMM E-Value=4.9e-16)                   29   4.1  
SB_4240| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   5.4  
SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.5  

>SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1855

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +1

Query: 163  IQACHLTTGYSPHGAKIPSYD 225
            IQACH+T+G S HGA +   D
Sbjct: 1249 IQACHVTSGLSDHGAVLFEID 1269


>SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031)
          Length = 753

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +1

Query: 163 IQACHLTTGYSPHGAKIPSYD 225
           IQACH+T+G S HGA +   D
Sbjct: 427 IQACHVTSGLSDHGAVLFEID 447


>SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1142

 Score = 25.4 bits (53), Expect(2) = 3.5
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 5/48 (10%)
 Frame = +2

Query: 95  IKTTVMPVDQIQYSERYTDDVYEYRHVILPP-----DIARMVPKSHLM 223
           I T      ++  +E Y DD Y+Y+  I        ++A+MVP +H M
Sbjct: 390 IGTPYWMAPEVVVTETYKDDPYDYKADIWSAGITLIELAQMVPPNHNM 437



 Score = 21.8 bits (44), Expect(2) = 3.5
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +2

Query: 287 HNPEPHVLLFRRPRTDIP 340
           HN  P  +LF+ P++D P
Sbjct: 435 HNMHPMRVLFKIPKSDPP 452


>SB_20327| Best HMM Match : LIM (HMM E-Value=4.9e-16)
          Length = 339

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +2

Query: 125 IQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSP-GW 271
           + Y+  +T +      ++L PD   ++ KSHL  +  +R+L V   P GW
Sbjct: 236 LAYARAFTGNRDRRDSLLLKPDTTCLISKSHLFCDYGFRHLVVGLLPNGW 285


>SB_4240| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 572

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -2

Query: 223 HKMGFWHHAGYIRW*DDMPVFVDVI 149
           HK+G W H G  R+ D + VF+ V+
Sbjct: 111 HKIGSWKHPGVARFPDFLAVFLAVL 135


>SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = -3

Query: 318 LNNRTWGSGLCTIKWSQPG 262
           + NR W  GLC I++ QPG
Sbjct: 3   IKNRKWTFGLCGIEFLQPG 21


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,496,464
Number of Sequences: 59808
Number of extensions: 360819
Number of successful extensions: 778
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 709
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 778
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1572561250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -