SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4501| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.36 
SB_1739| Best HMM Match : Beta-lactamase (HMM E-Value=3.7e-22)         32   0.36 
SB_35385| Best HMM Match : SRP54_N (HMM E-Value=7.2)                   30   1.4  
SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.3  
SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.3  
SB_47393| Best HMM Match : Remorin_C (HMM E-Value=1.4)                 28   5.8  
SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85)             28   7.7  
SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.7  
SB_41366| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  
SB_8160| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.7  

>SB_4501| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 3/63 (4%)
 Frame = +3

Query: 192 LGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRALVAEAVRRLKE---KKQPCHEIS 362
           LG K  + + +R+  APY + ++  VD+V R   Q   +A+A RR KE    ++PC   +
Sbjct: 80  LGHKADVEVNSRSYQAPYPLGQKSDVDIVFR--TQYITLADANRRFKELVKNQRPCQCSN 137

Query: 363 VDS 371
           ++S
Sbjct: 138 LES 140


>SB_1739| Best HMM Match : Beta-lactamase (HMM E-Value=3.7e-22)
          Length = 539

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = +3

Query: 6   IRKRNAPPTLPVSLLVSCETNFKIKT-FTTMLREKSSCENRHSTEQDRRQLPSNRLP 173
           +R R +  T  +   VSC     I   F +M   KSSC+N  S EQ +R    +R P
Sbjct: 9   VRFRRSTRTWQIIASVSCVVAVVIAILFASMCYSKSSCKNYKSCEQQKRSPLDSRCP 65


>SB_35385| Best HMM Match : SRP54_N (HMM E-Value=7.2)
          Length = 257

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -3

Query: 375 IKNLQIFHDTVVSFLL-IFEQLQQQGHVAPITF 280
           +  + IFHDTV  F    FE+ ++Q HV P ++
Sbjct: 155 VNTMGIFHDTVAEFCTQYFERFRRQTHVTPKSY 187


>SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 655

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +3

Query: 93  MLREK-SSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPV 269
           +LR+K S  E +   E +  Q    R   +E L   L+  L  +  AR A    R     
Sbjct: 216 LLRQKYSDAEAQAILEAENLQEEKRRREELERLHQELQNILLAEKEAREAETNARA---- 271

Query: 270 DLVERLLEQRALVAEAVRRLKEKK 341
            L E+LLE+     E + RLKE+K
Sbjct: 272 -LQEKLLEEEKKRLEELERLKEEK 294


>SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1126

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +3

Query: 99  REKSSCENRHSTEQDR-RQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDL 275
           R K + E +   E++R  QL   R   +EE     ++K    A  RA     R++E ++ 
Sbjct: 756 RLKYAIEEKAKKERERMEQLEIQRQKKVEEQKKKREEKEKRVAELRAE----RQRELMEK 811

Query: 276 VERLLEQRALVAEAVRRLKEKKQ 344
            ++LLE+  L++    + K+KK+
Sbjct: 812 KKQLLEKDKLISTLTEKAKKKKE 834


>SB_47393| Best HMM Match : Remorin_C (HMM E-Value=1.4)
          Length = 396

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +3

Query: 27  PTLPVSLLVSCETNFKIKTFTTM--LREKSSCENRHSTEQDRRQLPSNRLPPIEELTLGL 200
           PTL + +L+  +T  +      +   ++K+S  +R S   DRR   SN+L       L +
Sbjct: 203 PTLTMEMLLEKQTQVENNRIRQLEKKKKKASARSRSSDASDRRASRSNKL----REALEM 258

Query: 201 KQKLHLQARARAA 239
             KL  +  ARAA
Sbjct: 259 ADKLAKEKSARAA 271


>SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85)
          Length = 1459

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = -2

Query: 196  PRVSSSIGGNLLEGNCLLSCSVLWRFSQLDFSLSIVVKVLILKFVSHETRRLT 38
            P+ ++S+G +L  G+ L     +W F    F++ ++V  L L  V+H    LT
Sbjct: 1324 PKTAASLGSSLYAGSHLNVG--IWSFGTFVFAVCVIVSNLKLALVTHYWTWLT 1374


>SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1894

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 20/113 (17%), Positives = 49/113 (43%), Gaps = 6/113 (5%)
 Frame = +3

Query: 18   NAPPTLPV------SLLVSCETNFKIKTFTTMLREKSSCENRHSTEQDRRQLPSNRLPPI 179
            N  PT P       S +   +T++ +      L + +    +   +Q  ++     +   
Sbjct: 823  NLAPTAPAQQDPRSSAVSDYQTSYSVNLAQAQLNQYNYANAQQQQQQQFQEFQREMMMQQ 882

Query: 180  EELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRALVAEAVRRLKEK 338
            + +   L++ L +Q   + A       +   L++++LEQ+  +A+  +++KEK
Sbjct: 883  QSMMFQLQEMLRVQQTVQHAHEVTDHGQVSLLMQQILEQQKKLADLEQKIKEK 935


>SB_41366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 224

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 3/49 (6%)
 Frame = +3

Query: 57  CETNFKIKTFT-TMLREKSSCE--NRHSTEQDRRQLPSNRLPPIEELTL 194
           C +N   KTF  ++L  +S+C    RH   QDRR LP   L     +TL
Sbjct: 153 CNSNIHRKTFRQSILVTQSNCIFFQRHQRMQDRRLLPRTILTTPMTVTL 201


>SB_8160| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 516

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 17/45 (37%), Positives = 22/45 (48%)
 Frame = -2

Query: 211 SFCFRPRVSSSIGGNLLEGNCLLSCSVLWRFSQLDFSLSIVVKVL 77
           SF FRP+V  S   N   G CL   S +        +++IV KVL
Sbjct: 231 SFLFRPKVKESKDENTFMGICLYGKSGVLIIDAQSEAITIVRKVL 275


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,521,977
Number of Sequences: 59808
Number of extensions: 393712
Number of successful extensions: 957
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 907
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 957
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1681430875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -