SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.)              99   2e-21
SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.96 
SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05)            30   0.96 
SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32)                 30   1.3  
SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35)                      28   3.9  
SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05)               28   3.9  
SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05)                 28   3.9  
SB_38790| Best HMM Match : E-MAP-115 (HMM E-Value=1.9)                 27   6.8  
SB_20290| Best HMM Match : ig (HMM E-Value=2.9e-15)                    27   6.8  
SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.0  
SB_22559| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.0  
SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.0  

>SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 100

 Score = 99.1 bits (236), Expect = 2e-21
 Identities = 45/49 (91%), Positives = 49/49 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEGSKTWDR++MRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIADA
Sbjct: 52  GEGSKTWDRYEMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 100



 Score = 68.5 bits (160), Expect = 3e-12
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query: 199 RNVRSLEKV--CADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           + VR+  KV  CADLI GAK++KL+VKGPVRMPTK LRITTRKTP
Sbjct: 6   KKVRTTRKVTVCADLIRGAKEKKLKVKGPVRMPTKFLRITTRKTP 50


>SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 437

 Score = 30.3 bits (65), Expect = 0.96
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%)
 Frame = +3

Query: 168 YSPHQDHSYFSQCALTR---EGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 317
           Y P   +SY + CA T+   +G        +   A+ +   PH N DPA+  P
Sbjct: 267 YDPQNPYSYGAYCAYTQAQPQGFNAQAYPYENNSASARPAMPHYNSDPAHTEP 319


>SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05)
          Length = 584

 Score = 30.3 bits (65), Expect = 0.96
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +3

Query: 198 SQCALTREGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 317
           S C     GLC P  +   ++ +  GPSP +  DP+   P
Sbjct: 412 SICLCAPSGLCVPIHFLPNSDPSLAGPSPSSKLDPSIRDP 451


>SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32)
          Length = 2436

 Score = 29.9 bits (64), Expect = 1.3
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +1

Query: 133 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCAD 234
           + + K Q E + IH + +T   ++VRSLE+ C +
Sbjct: 663 RQLHKIQEESTRIHHLAVTALEKDVRSLEQRCLE 696


>SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 5659

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 15/65 (23%), Positives = 32/65 (49%)
 Frame = +2

Query: 278  QSACQPRSCVSPPVKLLGGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEV 457
            ++   P S V P + ++  +   T + + +++H R     +P   V  +T++  E  +  
Sbjct: 1832 ETTMAPESTVGPEITIV--DNFSTRNNYGVKVHSRPGTTLAPKSTVASVTTMAPESTLAP 1889

Query: 458  EVTIA 472
            E+TIA
Sbjct: 1890 EITIA 1894


>SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35)
          Length = 1049

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 19/47 (40%), Positives = 22/47 (46%)
 Frame = -1

Query: 499 FYWRLCLRVGDGHLNLYTGLDVN*GDLFHNFRGRV*VDHSLVDSHLK 359
           FY  L L V D    L  G+D    DLF   R    VD+SLV   +K
Sbjct: 405 FYSNLVLEVSDNETELVNGIDQLWDDLFVESRR---VDYSLVSVKMK 448


>SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05)
          Length = 1878

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = +3

Query: 273  GPSPHANQDPAYHHP*NSLVVKVQRP 350
            GP PH+ Q P  HHP +   ++   P
Sbjct: 1189 GPPPHSMQQPLLHHPQDPHHIQAMEP 1214


>SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05)
          Length = 1023

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +3

Query: 45  VQR*TIFDLKSCLSRPEFNKQHGSRCS-VRQRHRETPGRGLPYSPHQ 182
           + R ++   +S ++   +  +H S  S V+ R+R   G+G+ Y PHQ
Sbjct: 735 LHRLSVIPNRSQINVTRYRPRHPSSTSTVKYRYRLWTGKGVDYQPHQ 781


>SB_38790| Best HMM Match : E-MAP-115 (HMM E-Value=1.9)
          Length = 198

 Score = 27.5 bits (58), Expect = 6.8
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 111 GSRCSVRQRHRETPGRGLPYSPHQDHSYFSQCALTREGL 227
           GSR   R RHR  PGR  P  P    S+ ++ A  R GL
Sbjct: 2   GSRSHRRARHRGGPGRRRPLKP----SFTTEGAAARLGL 36


>SB_20290| Best HMM Match : ig (HMM E-Value=2.9e-15)
          Length = 978

 Score = 27.5 bits (58), Expect = 6.8
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = +3

Query: 270 KGPSPHANQDPAYHHP*NSLVVKVQRPGIVFRCEST 377
           +GPSP+A   PA  +P      KV+R G     E T
Sbjct: 654 EGPSPYAQDGPAAEYPVKKRERKVRREGQFSNVEIT 689


>SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 561

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -3

Query: 506 KNILLAALPTRRRWSPQP 453
           +N+++  LPT +RW P P
Sbjct: 180 RNVVIQRLPTSQRWQPYP 197


>SB_22559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 944

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = +1

Query: 226 CADLINGAKKQKLRVKGPVRMPTKILRITTRKTP-WW*R 339
           C D       Q+LR+  P+ +P KI  + TR+   WW R
Sbjct: 23  CMDTYCKVHLQRLRMGIPLAVPCKICGVGTRRYEIWWNR 61


>SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 361

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 100 TSNMAAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEK 222
           T N A+ ++S   + +PQA + P+H   I + SRN  ++ K
Sbjct: 306 TLNSASVILS---LAEPQAGILPVHPHSIEIASRNRDAIAK 343


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,414,030
Number of Sequences: 59808
Number of extensions: 361857
Number of successful extensions: 749
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 710
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 748
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1123894172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -