SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0)                192   2e-49
SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1)                     30   1.1  
SB_37766| Best HMM Match : IncA (HMM E-Value=0.4)                      29   1.9  
SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24)               28   5.9  
SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.9  
SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25)             27   7.9  
SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.9  

>SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0)
          Length = 166

 Score =  192 bits (468), Expect = 2e-49
 Identities = 98/160 (61%), Positives = 117/160 (73%), Gaps = 4/160 (2%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           ML+PK+NRV IYEYLFKEGV VAKKD+++PKHT++E +PNL VIKA+QSLKSRGYV+E+F
Sbjct: 1   MLIPKKNRVIIYEYLFKEGVCVAKKDFNSPKHTQIENVPNLHVIKALQSLKSRGYVEEKF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSV-RTETVRRGPVGR--PDAPARSAE 406
            W+H+YW LTNEGI YLR FLHLP EIVPATL+R V R ET R  P G   P  P    +
Sbjct: 61  CWKHYYWNLTNEGITYLRDFLHLPTEIVPATLRRQVTRAETARPRPKGMDGPRGPGEGGD 120

Query: 407 -DRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
            DR +YRR P  PGV   + K   G G    EF+ G+GRG
Sbjct: 121 RDRESYRRGP-PPGV---EGKGGAGSGFKP-EFRQGFGRG 155


>SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1)
          Length = 2075

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%)
 Frame = +2

Query: 425 RTPAAPGVAPHDK-KADVGPGS 487
           +TPA PG+AP D  K  VGPG+
Sbjct: 365 KTPALPGIAPSDALKGTVGPGN 386


>SB_37766| Best HMM Match : IncA (HMM E-Value=0.4)
          Length = 585

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = +2

Query: 434 AAPGVAPHDKKADVGP 481
           A PG+APHDKK+  GP
Sbjct: 545 ARPGLAPHDKKSGKGP 560


>SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1705

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 481
           +GP+G P  P       +  R  P  PG  P  K+ + GP
Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236


>SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 828

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 4/53 (7%)
 Frame = +2

Query: 299 HLPPEIVPATLKRSVRTETVRRGPVGRPDAP----ARSAEDRSAYRRTPAAPG 445
           HL P ++   +  S+      RGP GRP  P     R    +   R  P +PG
Sbjct: 110 HLSPAVIRLCMGGSLTCPPGPRGPPGRPGHPGQKGTRGRRGQRGRRGNPGSPG 162


>SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24)
          Length = 270

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 481
           +GP+G P  P       +  R  P  PG  P  K+ + GP
Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236


>SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2070

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 80   VAIYEYLFKEGVMVAKKDYHAPKHTELEKIPN 175
            +A +++L K  +   +    APK   +EK+PN
Sbjct: 1395 IADFDFLSKSAIQALRLPVPAPKVNNMEKVPN 1426


>SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25)
          Length = 578

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 19/73 (26%), Positives = 37/73 (50%)
 Frame = +2

Query: 128 KDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLP 307
           +DY A   T    I  +  ++ +  + SRG+VK+ +A+    W   +  + +L  +L L 
Sbjct: 118 EDYDASGGTVY--ITAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLS-YLSLA 174

Query: 308 PEIVPATLKRSVR 346
           P+I   +  R++R
Sbjct: 175 PDIASLSGIRTLR 187


>SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6406

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +2

Query: 374  GRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGS 487
            G P+  + S+E R    RT  AP   P  K     PG+
Sbjct: 6325 GEPEGTSPSSESRIPVGRTTKAPTTKPASKTTTTRPGT 6362


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,639,565
Number of Sequences: 59808
Number of extensions: 325538
Number of successful extensions: 1088
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1005
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1088
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1300738331
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -