SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   2e-05
SB_8973| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   2.5  
SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06)                 28   3.3  
SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1)                      27   5.7  
SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.7  
SB_3052| Best HMM Match : Peptidase_S8 (HMM E-Value=0)                 26   10.0 

>SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 54

 Score = 45.2 bits (102), Expect = 2e-05
 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = +2

Query: 173 HWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKEG-KPTPPKKAVASS 310
           +WS+KA          MRHLK+V RRF+NGF+EG +    KK VA++
Sbjct: 2   NWSMKAKRRTTTGTGRMRHLKLVYRRFQNGFQEGTQAKSQKKNVAAA 48


>SB_8973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 28.3 bits (60), Expect = 2.5
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = -2

Query: 173 GRIVILLQDIHIGRILIFECDMTIYHIFCITYGSYFGAYRSLRYRFVILSLLTI 12
           G I+ LL+D  I  I I   D++++ +  IT   YFG +  +R  F    +LTI
Sbjct: 106 GVIICLLKDF-INTIAI---DVSLFSLAFITIDRYFGVFFPMRKYFTRTLILTI 155


>SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06)
          Length = 819

 Score = 27.9 bits (59), Expect = 3.3
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = -2

Query: 116 CDMTIYHIFCITYGSYFGA 60
           CD +IYHI+ + Y  ++GA
Sbjct: 355 CDSSIYHIYRLKYAVHYGA 373


>SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1)
          Length = 364

 Score = 27.1 bits (57), Expect = 5.7
 Identities = 8/30 (26%), Positives = 16/30 (53%)
 Frame = +1

Query: 142 WISCSKITILPLVSEG*AQEDYWNWPHASF 231
           W++C K+ +LP+ ++      Y  W +  F
Sbjct: 136 WVNCDKVRLLPMRADEVGARVYARWTNGQF 165


>SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 525

 Score = 27.1 bits (57), Expect = 5.7
 Identities = 8/30 (26%), Positives = 16/30 (53%)
 Frame = +1

Query: 142 WISCSKITILPLVSEG*AQEDYWNWPHASF 231
           W++C K+ +LP+ ++      Y  W +  F
Sbjct: 297 WVNCDKVRLLPMRADEVGARVYARWTNGQF 326


>SB_3052| Best HMM Match : Peptidase_S8 (HMM E-Value=0)
          Length = 1124

 Score = 26.2 bits (55), Expect = 10.0
 Identities = 9/19 (47%), Positives = 15/19 (78%)
 Frame = +3

Query: 240 SGGASVMVLKKGNQRRPRR 296
           S G+ V +L+K N+RRP++
Sbjct: 259 SNGSGVFILQKPNERRPKK 277


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,250,894
Number of Sequences: 59808
Number of extensions: 186211
Number of successful extensions: 705
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 620
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 705
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 715479706
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -