SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33021| Best HMM Match : No HMM Matches (HMM E-Value=.)             221   3e-58
SB_57838| Best HMM Match : No HMM Matches (HMM E-Value=.)             141   5e-34
SB_46051| Best HMM Match : ubiquitin (HMM E-Value=0)                  141   5e-34
SB_25984| Best HMM Match : ubiquitin (HMM E-Value=0)                  141   5e-34
SB_28758| Best HMM Match : ubiquitin (HMM E-Value=1.5e-29)            127   7e-30
SB_20850| Best HMM Match : ubiquitin (HMM E-Value=0.00037)             72   4e-13
SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10)             49   3e-06
SB_59029| Best HMM Match : Pkinase (HMM E-Value=0)                     45   6e-05
SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11)                   38   0.007
SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12)              38   0.007
SB_49791| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.009
SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05)             33   0.15 
SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.27 
SB_22742| Best HMM Match : ubiquitin (HMM E-Value=0.01)                32   0.47 
SB_54258| Best HMM Match : ubiquitin (HMM E-Value=0.00055)             31   1.1  
SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18)                30   1.4  
SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8)                    29   4.4  
SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5)                28   5.8  
SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  
SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)                 28   7.6  
SB_31564| Best HMM Match : ubiquitin (HMM E-Value=0.0026)              28   7.6  
SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  
SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)                 28   7.6  

>SB_33021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score =  221 bits (541), Expect = 3e-58
 Identities = 112/150 (74%), Positives = 116/150 (77%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            KNY+TP          KLAVL++YKVDENGKI RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKNYTTPKKIKHKKKKVKLAVLKYYKVDENGKITRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF 178
           C  E CGAGVFMA   DR YCGKC  T VF
Sbjct: 121 CPSESCGAGVFMASHFDRQYCGKCCLTYVF 150


>SB_57838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 533

 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526


>SB_46051| Best HMM Match : ubiquitin (HMM E-Value=0)
          Length = 381

 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374


>SB_25984| Best HMM Match : ubiquitin (HMM E-Value=0)
          Length = 147

 Score =  141 bits (341), Expect = 5e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 40/69 (57%), Positives = 52/69 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQI VK    KT TL+VE SDT+E+VK KIQ++EGIPP  QRL +  ++L D R+L+DYN
Sbjct: 77  MQISVKA-HWKTFTLDVEASDTVESVKEKIQNREGIPPKVQRLLYEEEELVDNRSLADYN 135

Query: 447 IQKESTLHL 421
           I++ S LHL
Sbjct: 136 IKQGSILHL 144


>SB_28758| Best HMM Match : ubiquitin (HMM E-Value=1.5e-29)
          Length = 142

 Score =  127 bits (307), Expect = 7e-30
 Identities = 61/63 (96%), Positives = 62/63 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 79  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 138

Query: 447 IQK 439
           IQK
Sbjct: 139 IQK 141


>SB_20850| Best HMM Match : ubiquitin (HMM E-Value=0.00037)
          Length = 150

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 33/35 (94%), Positives = 34/35 (97%)
 Frame = -1

Query: 522 IPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           IPP+QQRL FAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 2   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 36


>SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10)
          Length = 333

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           I V TLTG+ I +  + P  TI  VK  I+ K G P +QQRL F G+ L D  T     I
Sbjct: 73  IAVLTLTGERILIPFKSPKHTIIEVKYLIEAKGGYPKDQQRLVFNGQVLSDEDTFEKVGI 132

Query: 444 QKESTLHLV 418
              +TLHL+
Sbjct: 133 FAGATLHLI 141


>SB_59029| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 1023

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQ---DKEGIPPNQQRLXFAGKQLEDGRT 463
           V M I  KTL  +T  +E+   +T+  +K KI+    K+  P    +L +AGK L D   
Sbjct: 65  VNMIITFKTLQQQTFKVEIGEDETVLKLKQKIEADKGKDAYPHGNIKLIYAGKILNDDNP 124

Query: 462 LSDYNIQKES 433
           L +YNI ++S
Sbjct: 125 LKEYNIDEKS 134


>SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11)
          Length = 744

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDT-IENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           Q+F    T    TL    +D  +  +K++I+ K GIP + QRL F  K+L D  TL+  N
Sbjct: 7   QVFAALPTEDVCTLRDLTTDMHVFQLKSRIELKTGIPGDIQRLHFMNKELYDDATLAKVN 66

Query: 447 IQK 439
           +++
Sbjct: 67  LKQ 69


>SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12)
          Length = 348

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED-GRTLSDY 451
           M++ V    G   TL+V     +EN +A ++ + G+P ++  L   G QL D  +TL+ Y
Sbjct: 1   MKVTVTGEDGSIFTLDVSVDLEVENFRALLEFESGVPASEISLYHDGVQLSDLKKTLTAY 60

Query: 450 NIQKESTLHLV 418
           ++++   + +V
Sbjct: 61  SVKENDVILMV 71


>SB_49791| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 35

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 526
           M ++++TLTG    L V P +TI +VKAKIQ  E
Sbjct: 1   MDLYIQTLTGTAFELRVSPFETIMSVKAKIQRLE 34


>SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05)
          Length = 198

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 22/60 (36%), Positives = 31/60 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VKTL  +T T  V               +EGIP  +QRL F GK L+D + L +++
Sbjct: 1   MQVTVKTLDSETRTFTVS--------------EEGIPAERQRLIFKGKVLQDEKKLKEFD 46


>SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1076

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 15/66 (22%), Positives = 32/66 (48%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R+++ +     +G    L++  + TIE ++ ++ DK G PP  QR     K  +   +L 
Sbjct: 33  RLRVVVEDSETSGGAFNLQIPLNTTIEKLQNEVADKYGFPPKVQRWIIGKKMAKPNESLL 92

Query: 456 DYNIQK 439
              +++
Sbjct: 93  QCKVRE 98


>SB_22742| Best HMM Match : ubiquitin (HMM E-Value=0.01)
          Length = 792

 Score = 31.9 bits (69), Expect = 0.47
 Identities = 16/64 (25%), Positives = 34/64 (53%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           + ++T  G T+ +E+    ++E++KA+ + + GIP    RL      LED   + +    
Sbjct: 185 MLLQTRGGSTLEIEITERTSVEDLKAEAELRVGIPVELIRLQVNKVNLEDSEKICERGHL 244

Query: 441 KEST 430
           +++T
Sbjct: 245 QKAT 248


>SB_54258| Best HMM Match : ubiquitin (HMM E-Value=0.00055)
          Length = 411

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 18/66 (27%), Positives = 29/66 (43%)
 Frame = -1

Query: 618 FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQK 439
           FV    G+ ITL   P  +   ++     + G P     +    K LED  T++D + Q 
Sbjct: 169 FVVMPEGQVITLHCNPRQSFSELRNHFSSEFGQPAEAILMLHEDKILEDQGTIADLSHQP 228

Query: 438 ESTLHL 421
            +TL +
Sbjct: 229 GATLQI 234


>SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18)
          Length = 796

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = -1

Query: 525 GIPPNQQRLXFAGKQLEDGRTLSDYN 448
           GIP  +QRL F GK L+D + L +++
Sbjct: 1   GIPAERQRLIFKGKVLQDEKKLKEFD 26


>SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1353

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -1

Query: 564 TIENVKAKIQDKEGIPPNQQRLXFA-GKQLEDGRTLSDYNIQKESTLHL 421
           T+ ++K  + +K G+  +  RL    GK++ D   L DYNI    T+ L
Sbjct: 86  TVGDLKTMVTNKTGLHVSVFRLVIPEGKEMFDCNLLKDYNISTGDTIRL 134


>SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8)
          Length = 180

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 14/43 (32%), Positives = 19/43 (44%)
 Frame = -3

Query: 574 AVRYHRECES*NSRQRGNPSQSTEVDXCWKAAGRWTYPXGLQY 446
           +  Y +E E  + RQR    +S E D C K   R+T      Y
Sbjct: 39  STEYTQESEGLDERQRARGKKSFECDICGKCFSRFTITTKYNY 81


>SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5)
          Length = 635

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -1

Query: 300 ENGKIHRLRRECTGEQC 250
           + G+IH L++EC G QC
Sbjct: 106 DGGEIHNLQQECIGSQC 122


>SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 654

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 9/15 (60%), Positives = 12/15 (80%)
 Frame = +1

Query: 205 AVVTVLHHRHEHSGA 249
           A++TV+HHRH H  A
Sbjct: 525 AIITVIHHRHHHHPA 539


>SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)
          Length = 794

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 312 YKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRH 211
           YK D  GK+  L+R C  ++C    ++ V  D +
Sbjct: 364 YKCDNCGKVGHLKRVCQSKECKETKYVEVSVDNN 397


>SB_31564| Best HMM Match : ubiquitin (HMM E-Value=0.0026)
          Length = 309

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 16/69 (23%), Positives = 34/69 (49%), Gaps = 3/69 (4%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGR---TLSDYNI 445
           V  + G+T  +   P  +I  +K KI     +   +QRL +   +L++ +    LS++ +
Sbjct: 60  VAMMGGETTVIPYNPVMSIAELKLKISQNIRVDRLKQRLMYNDTELKENKGSGKLSEFGV 119

Query: 444 QKESTLHLV 418
              +T+ L+
Sbjct: 120 PPYATISLI 128


>SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 951

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = -1

Query: 312 YKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHS 190
           YK D  GK+  L+R C  ++C         + +  C +C S
Sbjct: 515 YKCDNCGKVGHLKRVCQSKECKKXXXXQGGKPKTACHRCGS 555


>SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)
          Length = 1750

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 312 YKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRH 211
           YK D  GK+  L+R C  ++C    ++ V  D +
Sbjct: 207 YKCDNCGKVGHLKRVCQSKECKETKYVEVSVDNN 240


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,565,166
Number of Sequences: 59808
Number of extensions: 312248
Number of successful extensions: 770
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 683
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 767
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1669334250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -