SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13)           30   0.96 
SB_22055| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.9  
SB_23818| Best HMM Match : PsbL (HMM E-Value=6.8)                      27   9.0  
SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26)                 27   9.0  
SB_9956| Best HMM Match : Polysacc_deac_1 (HMM E-Value=4.1)            27   9.0  

>SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13)
          Length = 661

 Score = 30.3 bits (65), Expect = 0.96
 Identities = 14/48 (29%), Positives = 28/48 (58%)
 Frame = +1

Query: 136 IASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           +A++N    G  P+   ++ D+  + P     F++++ G+AVFQ I+S
Sbjct: 128 LANQNKRFMGKSPRIGPKRPDE-KLTPRTTLFFVYLLFGAAVFQTIES 174


>SB_22055| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 377

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = -2

Query: 263 NTAEPHTTKMKRARSQGATGYWSSFSLVVLGTFPLIVMFL 144
           +TAEPHT   +  ++ G  G W  F +  L T PL+V  L
Sbjct: 138 STAEPHT---EMRQTSGCQGLWGQFIISALLT-PLVVHLL 173


>SB_23818| Best HMM Match : PsbL (HMM E-Value=6.8)
          Length = 377

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = -2

Query: 263 NTAEPHTTKMKRARSQGATGYWSSFSLVVLGTFPLIVMFL 144
           +TAEPHT   +  ++ G  G W  F +  L T PL+V  L
Sbjct: 138 STAEPHT---EMRQTSGWQGLWGQFIISALLT-PLVVHLL 173


>SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26)
          Length = 333

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +1

Query: 148 NITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQSIRL 288
           N ++ G    T       Y V  W+LA  IFV  G+ ++ II   RL
Sbjct: 2   NASLNGTSSPTLPSDPLWYVVLSWMLAGVIFVGNGTVMYLIITRRRL 48


>SB_9956| Best HMM Match : Polysacc_deac_1 (HMM E-Value=4.1)
          Length = 586

 Score = 27.1 bits (57), Expect = 9.0
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +3

Query: 276 INKTSLNHEDNWRTA-IENTIK*QHYPSKVRHNLHQHLFVDMRESVFG 416
           I  TSL + D WR A +E+ +    + SK       H  +DMR +  G
Sbjct: 300 IRPTSLKYRDVWRAAQVESKV----WDSKENLGAQPHAHIDMRAAYLG 343


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,064,140
Number of Sequences: 59808
Number of extensions: 332358
Number of successful extensions: 694
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 668
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 694
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1123894172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -