SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_11667| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-14)                 33   0.20 
SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4)                    29   3.3  
SB_9322| Best HMM Match : RGS (HMM E-Value=0.037)                      29   4.3  
SB_5826| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.6  

>SB_11667| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-14)
          Length = 348

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 119 LRTAEIVFSTYADSDSLERLCQFLVDVLIYGAQTRRLTEKVRRETQWAVLIYSSSPSSQA 298
           L  +E+VFS  A  ++   L  F  + LIY  ++R L   + R+ +W  L+  + P+SQA
Sbjct: 271 LLKSELVFSFIAWVETFMLLNSF-TNPLIYCLRSRELRHHMARKFKWVRLVAGADPTSQA 329


>SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4)
          Length = 173

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +2

Query: 221 RRLTEKVRRETQWAVLIYSSSPSSQAKGWRRAVTG 325
           +RLT   RR TQ  +L+ +S P+S    WRR   G
Sbjct: 20  KRLTTPYRRRTQMHLLVSTSRPAS---SWRRGFRG 51


>SB_9322| Best HMM Match : RGS (HMM E-Value=0.037)
          Length = 1068

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = +2

Query: 113 RRLRTAEIVFSTYADSDSLERLCQFLVDVLIYGAQTRRLTEKVRRETQWAVL 268
           ++ + A  ++ TY DS S  R C  L  +L+   ++ R +  V  E Q AVL
Sbjct: 781 QKSQQAAHIYKTYFDSSS--RRCVSLPSLLVASVESERPSSPVMAEAQQAVL 830


>SB_5826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 402

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +1

Query: 262 CVNLLVEPFVASEGLAEGGDRCLWYLKAPLRDREDP 369
           C  LLV  F+A    AE  +RCL  ++A  ++   P
Sbjct: 90  CAALLVAAFIAGSSYAESLERCLKEIQAAKKELRCP 125


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,799,692
Number of Sequences: 59808
Number of extensions: 407599
Number of successful extensions: 888
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 829
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 888
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1657237625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -