SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0)               313   7e-86
SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)                     29   2.5  
SB_41261| Best HMM Match : Metallothio_11 (HMM E-Value=0.74)           28   5.8  
SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14)                 28   5.8  
SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24)                   28   7.6  
SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  

>SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0)
          Length = 272

 Score =  313 bits (769), Expect = 7e-86
 Identities = 147/178 (82%), Positives = 164/178 (92%)
 Frame = +2

Query: 119 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKR 298
           VV +  +   A ++P+IKLFG+WS  DVQVSD+SL DYI+VKEKY+ YLPH+AGRYA KR
Sbjct: 69  VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISLTDYIAVKEKYSTYLPHTAGRYAAKR 128

Query: 299 FRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSG 478
           FRKAQCPIVER+TNS+MMHGRNNGKKLM VRI+KH+FEIIHLLTGENPLQVLV AIINSG
Sbjct: 129 FRKAQCPIVERITNSMMMHGRNNGKKLMTVRIIKHSFEIIHLLTGENPLQVLVNAIINSG 188

Query: 479 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGARE+AFRNIK+IAEC+ADELI
Sbjct: 189 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGARESAFRNIKSIAECLADELI 246



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/35 (54%), Positives = 26/35 (74%)
 Frame = +2

Query: 119 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSL 223
           VV +  +   A ++P+IKLFG+WS  DVQVSD+SL
Sbjct: 6   VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISL 40


>SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)
          Length = 145

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +3

Query: 3  PAFSRVLLTVRGYNFYLVIEKYQSWPRRTGM 95
          PAFSR+L TV    F  V  +  +WP   GM
Sbjct: 7  PAFSRILRTVSEQKFGCVFFEKPAWPPTRGM 37


>SB_41261| Best HMM Match : Metallothio_11 (HMM E-Value=0.74)
          Length = 328

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 12/30 (40%), Positives = 14/30 (46%)
 Frame = -2

Query: 640 CNTLCDCFNISECSLTCTCAQKPDCLVDSA 551
           C   C C   + C   CTC Q   C+V SA
Sbjct: 226 CCVTCRCSVCTCCPCDCTCLQCAPCIVFSA 255


>SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14)
          Length = 556

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 158 IPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYA 289
           IPE  L     C DV   +  LQ+++ + +KY  YL + A +Y+
Sbjct: 511 IPEEAL--NLECPDVDFRESVLQEFLLLDKKYESYLEYLALKYS 552


>SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24)
          Length = 553

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
 Frame = +3

Query: 27  TVRGYNFYLVIEKYQSWPR--RTGMTT*PR 110
           +V G NF++V++ +  WP    T  TT P+
Sbjct: 242 SVHGVNFFVVVDAHSKWPEIIATSSTTAPK 271


>SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 753

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 20/109 (18%), Positives = 41/109 (37%), Gaps = 1/109 (0%)
 Frame = +2

Query: 56  NRKVPIMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYI 235
           +R+  +  E+ W+  ++  G +   T   P    +   +L   WS     V D ++ ++I
Sbjct: 619 DRQQRVRIEDEWSSQISPRGGIPQGTRLAPLLFAVLVNRLADEWSTRLKYVDDATVLEFI 678

Query: 236 SVKE-KYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKL 379
                 Y   +     RYA +R  +      + +    + +G     KL
Sbjct: 679 PRNSPSYLPIVASGISRYATQRNMRLNPNKCKEMVIDFLHYGEQQKHKL 727


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,201,964
Number of Sequences: 59808
Number of extensions: 449935
Number of successful extensions: 1207
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1207
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1669334250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -