SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0)                      111   3e-25
SB_49776| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.36 
SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23)          31   0.82 
SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.9  
SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6)                    29   1.9  
SB_55854| Best HMM Match : NinE (HMM E-Value=2.1)                      29   1.9  
SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11)                  29   1.9  
SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07)                 28   4.4  
SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0)                       28   4.4  
SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0)                       28   4.4  
SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0)                        28   4.4  
SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25)                   28   4.4  
SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.4  
SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.4  
SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.4  
SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71)            28   5.8  
SB_6077| Best HMM Match : EGF (HMM E-Value=0)                          28   5.8  
SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.6  
SB_14940| Best HMM Match : fn2 (HMM E-Value=2.5e-08)                   27   7.6  
SB_12112| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.6  
SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.6  

>SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0)
          Length = 768

 Score =  111 bits (268), Expect = 3e-25
 Identities = 48/61 (78%), Positives = 56/61 (91%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y+K YKVGDIVD++ NGAVQKGMPHKVYHGKTGRVYNVT  ALGV+VNK+V+G+I+ KRI
Sbjct: 452 YLKCYKVGDIVDVKANGAVQKGMPHKVYHGKTGRVYNVTKRALGVVVNKQVKGKILAKRI 511

Query: 305 N 307
           N
Sbjct: 512 N 512



 Score = 30.7 bits (66), Expect = 0.82
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +3

Query: 36  MTNSKGYRRGTRXLVRSQVPH 98
           MTN+KGYRRGTR +   +  H
Sbjct: 423 MTNTKGYRRGTRYMFSKKFRH 443


>SB_49776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 290

 Score = 31.9 bits (69), Expect = 0.36
 Identities = 23/83 (27%), Positives = 35/83 (42%)
 Frame = +2

Query: 158 DIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSK 337
           DI G G+   GMP +      G+V ++   A GV++    R      ++   + H  HSK
Sbjct: 102 DIEGTGSYNGGMPQEDLRNTIGQVADL--GAAGVVMWGNRRDENTSPQVCKHINHYIHSK 159

Query: 338 CRQDFLKRVKENERLLKEAKAAG 406
               F+ R+K       E K  G
Sbjct: 160 L-GPFIHRMKTTAEKCSELKCRG 181


>SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23)
          Length = 565

 Score = 30.7 bits (66), Expect = 0.82
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 350 FLKRVKENERLLKEAKAAGKTVNLKRQPA-PPKAAHIVSGTEKPVLLAPIP 499
           F+KR +  +R L+E   A   +NL ++PA P K    +   EKPV   P P
Sbjct: 272 FVKRTQRRQRELEEVADA---INLAKRPAQPEKPLKFLVKVEKPVPRPPTP 319


>SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1551

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%)
 Frame = +2

Query: 50  GLPPRHQGTCSLAGSAHMELFRSP---RYMKVYKV 145
           G PP  +  C+ AGS H  ++R P   RY  VY++
Sbjct: 709 GAPPTQELPCAHAGSRHPSVYRYPTVIRYPAVYRL 743


>SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6)
          Length = 305

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = +2

Query: 413 VNLKRQPAPPKAAHIVSGTEKPVLLAPIPYE 505
           VN  +   PP A + ++  ++PVL  P+P++
Sbjct: 130 VNKSKAETPPPAYYTITSNQEPVLNMPVPWQ 160


>SB_55854| Best HMM Match : NinE (HMM E-Value=2.1)
          Length = 271

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +2

Query: 296 KRINIRVEH-VKHSKCRQDFLKRVKENERLLKEAKAAGKT 412
           +RI   ++H ++  K +QDF+  +KE  RL +E+++   T
Sbjct: 39  ERIQSCIDHKLEERKIKQDFVTLIKERNRLGRESRSGAST 78


>SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11)
          Length = 3369

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 11/27 (40%), Positives = 14/27 (51%)
 Frame = +1

Query: 235  RDCSCSRCDCQQACSRKDYTEAHQYPC 315
            +D +C  CD  Q C   + T  HQ PC
Sbjct: 2330 QDPNCGWCDSAQQCMPGNQTRPHQEPC 2356


>SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07)
          Length = 1458

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 18/60 (30%), Positives = 29/60 (48%)
 Frame = +2

Query: 296 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 475
           K I +  EH + S C Q F +    N  + ++  + GKT  + +     K  HI+S +EK
Sbjct: 413 KNIELLTEHWECSGCEQRFNRHDNYNRHVTEKRCSGGKTQLICK---GEKFKHIMSSSEK 469


>SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1020

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +2

Query: 122 RYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIP 295
           R+ K  ++G  DI+  R    +Q  +P K++H     ++    H     V +  R R   
Sbjct: 494 RHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAERVLQLARDRFFW 553

Query: 296 KRINIRVEHVKHSKCRQDFLKRVKENER 379
            R+   +EH   S CR    KR K  +R
Sbjct: 554 PRMQQDIEHYVTSVCRCIKQKRPKHAQR 581


>SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1387

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +2

Query: 122 RYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIP 295
           R+ K  ++G  DI+  R    +Q  +P K++H     ++    H     V +  R R   
Sbjct: 731 RHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAERVLQLARDRFFW 790

Query: 296 KRINIRVEHVKHSKCRQDFLKRVKENER 379
            R+   +EH   S CR    KR K  +R
Sbjct: 791 PRMQQDIEHYVTSVCRCIKQKRPKHAQR 818


>SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1623

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +2

Query: 122  RYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIP 295
            R+ K  ++G  DI+  R    +Q  +P K++H     ++    H     V +  R R   
Sbjct: 1282 RHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLGYKELHEEMGHLGAERVLQLARDRFFW 1341

Query: 296  KRINIRVEHVKHSKCRQDFLKRVKENER 379
             R+   +EH   S CR    KR K  +R
Sbjct: 1342 PRMQQDIEHYVTSVCRCIKQKRPKHAQR 1369


>SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25)
          Length = 440

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +2

Query: 122 RYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIP 295
           R+ K  ++G  DI+  R    +Q  +P K++H     ++    H     V +  R R   
Sbjct: 178 RHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLGYKELHEEMGHLGAERVLQLARDRFFW 237

Query: 296 KRINIRVEHVKHSKCRQDFLKRVKENER 379
            R+   +EH   S CR    KR K  +R
Sbjct: 238 PRMQQDIEHYVTSVCRCIKQKRPKHAQR 265


>SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4529

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 15/71 (21%), Positives = 35/71 (49%)
 Frame = +2

Query: 296  KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 475
            +++ +        K R + ++   + +RLL+++++  K   L++ P P  A  + +  E 
Sbjct: 1536 RKLTVEQREPYRLKARDNRVRLKDQEKRLLRQSESEKKHAALEQPPTP--APQVETQPET 1593

Query: 476  PVLLAPIPYEF 508
            P+  A  P+ F
Sbjct: 1594 PIHQAASPFVF 1604


>SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 456

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 13/47 (27%), Positives = 26/47 (55%)
 Frame = +2

Query: 182 QKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEH 322
           ++G PH+ + G TGR       A+  + +K +  +++ +R NI + H
Sbjct: 108 KEGKPHENHSGLTGR-----RGAMRALASKDINAQLLKERFNINMPH 149


>SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1984

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +2

Query: 122  RYMKVYKVG--DIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIP 295
            R+ K  ++G  DI+  R    +Q  +P K++H     ++    H     V +  R R   
Sbjct: 1066 RHWKKLELGKDDILRRRIGPRLQLVLPRKLHHLVYKELHEEMGHLGAERVLQLARDRFFW 1125

Query: 296  KRINIRVEHVKHSKCRQDFLKRVKENER 379
             R+   +EH   S CR    KR K  +R
Sbjct: 1126 PRMQQDIEHYVTSVCRCIKQKRPKHAQR 1153


>SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71)
          Length = 1139

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = +1

Query: 175 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQ 270
           C+S    +      D+S VQ+DCS  R DC +
Sbjct: 736 CNSSDIGSTPTILSDKSPVQQDCSSIRRDCSR 767


>SB_6077| Best HMM Match : EGF (HMM E-Value=0)
          Length = 1165

 Score = 27.9 bits (59), Expect = 5.8
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 17  CNTRLEDDELQGLPPRHQGTC 79
           CNT +  DE Q  P +HQGTC
Sbjct: 174 CNTDI--DECQSSPCKHQGTC 192


>SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6753

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 14/52 (26%), Positives = 21/52 (40%)
 Frame = +1

Query: 160  HQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQACSRKDYTEAHQYPC 315
            H + WC++     +   W +     + C  S C    ACS+   T A  Y C
Sbjct: 1804 HNKPWCATTDDFDRDRLWDNMKVDFKPCDASPCRGNGACSQ--VTPAFTYTC 1853


>SB_14940| Best HMM Match : fn2 (HMM E-Value=2.5e-08)
          Length = 93

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 14/52 (26%), Positives = 21/52 (40%)
 Frame = +1

Query: 160 HQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQACSRKDYTEAHQYPC 315
           H + WC++     +   W +     + C  S C    ACS+   T A  Y C
Sbjct: 30  HNKPWCATTDDFDRDRLWDNMKVDFKPCDASPCRGNGACSQ--VTPAFTYTC 79


>SB_12112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 102

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +1

Query: 94  RTHGTIPLSTXHESVQSWRHCR-HQR 168
           R  G IP+   H S +SWRH R HQR
Sbjct: 77  RARGVIPV---HVSARSWRHSRTHQR 99


>SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 865

 Score = 27.5 bits (58), Expect = 7.6
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +3

Query: 318 SMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLP 452
           ++S+ PS  KT+   ++R     RKP +PAR ST       ++ P
Sbjct: 633 TLSAPPSRPKTAPTSAQRTPEPIRKPLVPARMSTDSTDAFKIQAP 677


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,335,319
Number of Sequences: 59808
Number of extensions: 366573
Number of successful extensions: 1161
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1061
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1156
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1264269032
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -