SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_1572| Best HMM Match : Drf_FH1 (HMM E-Value=0.27)                   30   0.45 
SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   3.2  
SB_59042| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.7  
SB_52162| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.7  
SB_35017| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.7  
SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23)                    26   9.7  

>SB_1572| Best HMM Match : Drf_FH1 (HMM E-Value=0.27)
          Length = 335

 Score = 30.3 bits (65), Expect = 0.45
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = -3

Query: 186 PYLRI-KPCLLEQDRHXPRSLSVSARVRIPNIC 91
           PY RI K CL++QD   P+   V+   RIP  C
Sbjct: 27  PYRRIPKRCLVKQDHRIPKRCPVTQDDRIPKRC 59


>SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1008

 Score = 27.5 bits (58), Expect = 3.2
 Identities = 11/22 (50%), Positives = 12/22 (54%)
 Frame = -3

Query: 207 HCLHMFKPYLRIKPCLLEQDRH 142
           H LH   P    KPCLL+ D H
Sbjct: 318 HGLHFGSPARARKPCLLDHDEH 339


>SB_59042| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 25.8 bits (54), Expect = 9.7
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +1

Query: 88  HANIWYSHPRRYGQGSRXMP 147
           HA  WY+H   YG+G +  P
Sbjct: 51  HALRWYNHIVSYGEGKQNFP 70


>SB_52162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 81

 Score = 25.8 bits (54), Expect = 9.7
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +1

Query: 88  HANIWYSHPRRYGQGSRXMP 147
           HA  WY+H   YG+G +  P
Sbjct: 25  HALRWYNHIVSYGEGKQNFP 44


>SB_35017| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 25.8 bits (54), Expect = 9.7
 Identities = 8/34 (23%), Positives = 17/34 (50%)
 Frame = +2

Query: 149 SCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           +C +   ++   G N+CR C   + +D   + +D
Sbjct: 66  ACCDGQDMVNDNGANVCRNCGVHHGYDYAVEYVD 99


>SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23)
          Length = 3368

 Score = 25.8 bits (54), Expect = 9.7
 Identities = 10/14 (71%), Positives = 11/14 (78%)
 Frame = -3

Query: 174 IKPCLLEQDRHXPR 133
           IKP LLE+D H PR
Sbjct: 685 IKPVLLEEDMHNPR 698


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,179,534
Number of Sequences: 59808
Number of extensions: 157550
Number of successful extensions: 374
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 353
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 374
length of database: 16,821,457
effective HSP length: 73
effective length of database: 12,455,473
effective search space used: 523129866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -