SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39)        113   9e-26
SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.)              108   3e-24
SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35)              105   3e-23
SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.)             104   5e-23
SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.)             104   5e-23
SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09)              104   5e-23
SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.)             104   5e-23
SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42)           104   5e-23
SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.)              104   5e-23
SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42)           104   5e-23
SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.)             104   5e-23
SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.)             104   5e-23
SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.)             104   5e-23
SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42)          104   5e-23
SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32)              104   5e-23
SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.)             104   5e-23
SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42)           104   5e-23
SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42)           104   5e-23
SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.)               104   5e-23
SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16)                104   7e-23
SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41)           103   1e-22
SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41)              103   2e-22
SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.)             102   2e-22
SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.)             101   4e-22
SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.)              96   3e-20
SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.)              96   3e-20
SB_35876| Best HMM Match : Histone (HMM E-Value=5.1)                   96   3e-20
SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6)               96   3e-20
SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6)               96   3e-20
SB_17103| Best HMM Match : Histone (HMM E-Value=0.65)                  96   3e-20
SB_15200| Best HMM Match : Histone (HMM E-Value=0.22)                  96   3e-20
SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.)              94   1e-19
SB_14580| Best HMM Match : No HMM Matches (HMM E-Value=.)              76   3e-14
SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   5e-14
SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07)               74   1e-13
SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08)               74   1e-13
SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08)               74   1e-13
SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07)               74   1e-13
SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08)               74   1e-13
SB_31724| Best HMM Match : Histone (HMM E-Value=4.8e-18)               40   0.002
SB_49221| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.009
SB_32303| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_46905| Best HMM Match : WD40 (HMM E-Value=8.9e-12)                  29   3.3  
SB_41851| Best HMM Match : Pkinase (HMM E-Value=0)                     29   3.3  
SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15)                 29   4.4  
SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.8  
SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  

>SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39)
          Length = 370

 Score =  113 bits (273), Expect = 9e-26
 Identities = 59/93 (63%), Positives = 66/93 (70%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L 
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLF 105

Query: 439 RRHQLVCYSRQTCDHHAEGYSTCSTNPW*TCLN 537
               L     +      +G+  C  +PW   +N
Sbjct: 106 EDTNLCAIHAKRVTIMPQGHPACPPHPWRESVN 138



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45


>SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 251

 Score =  108 bits (260), Expect = 3e-24
 Identities = 55/59 (93%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEA+EAYL  L
Sbjct: 43  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGL 101



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 28/45 (62%), Positives = 31/45 (68%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAP +    +  +K       VKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPPRD---QGRQKERSIHRRVKKPHRYRPG 42



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPK 493
           GLFEDTNLCAIHAKRVT+  K
Sbjct: 100 GLFEDTNLCAIHAKRVTLCQK 120


>SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35)
          Length = 136

 Score =  105 bits (252), Expect = 3e-23
 Identities = 56/88 (63%), Positives = 61/88 (69%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L 
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLF 105

Query: 439 RRHQLVCYSRQTCDHHAEGYSTCSTNPW 522
               L     +      +       +PW
Sbjct: 106 EDTNLCAIHAKRVTIMPKDIQLAPPHPW 133



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45


>SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQ ARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQMARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 94

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 4   TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 62



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 61  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 94


>SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 260

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 170 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 228



 Score = 84.2 bits (199), Expect = 8e-17
 Identities = 38/39 (97%), Positives = 39/39 (100%)
 Frame = +3

Query: 141 TARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           TARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 131 TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 169



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 227 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 260


>SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09)
          Length = 110

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45


>SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 205

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 115 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 173



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 70  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 114



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 172 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 205


>SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 131

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 41  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 99



 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 39/40 (97%), Positives = 40/40 (100%)
 Frame = +3

Query: 138 QTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           QTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   QTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 40



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 98  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 131


>SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 94

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 4   TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 62



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 61  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 94


>SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32)
          Length = 162

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLA KAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLAIKAARKSAPATGGVKKPHRYRPG 45



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQ 502
           GLFEDTNLCAIHAKRVTIMPKDI+
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIR 126


>SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 493

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42)
          Length = 136

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score =  104 bits (250), Expect = 5e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKR 475
           GLFEDTNLCAIHAKR
Sbjct: 103 GLFEDTNLCAIHAKR 117


>SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16)
          Length = 117

 Score =  104 bits (249), Expect = 7e-23
 Identities = 52/56 (92%), Positives = 54/56 (96%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 101



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 32.7 bits (71), Expect = 0.27
 Identities = 13/15 (86%), Positives = 13/15 (86%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKR 475
           G  EDTNLCAIHAKR
Sbjct: 103 GFIEDTNLCAIHAKR 117


>SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41)
          Length = 136

 Score =  103 bits (248), Expect = 1e-22
 Identities = 53/59 (89%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSLAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41)
          Length = 136

 Score =  103 bits (246), Expect = 2e-22
 Identities = 52/59 (88%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ AL+EASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALKEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  102 bits (245), Expect = 2e-22
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA+EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLIREIAQDFKTDLRFQSSAVLALQEAAEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  101 bits (243), Expect = 4e-22
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQ LVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQLLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2480

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45


>SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 47/51 (92%), Positives = 49/51 (96%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEA 411
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA 96


>SB_35876| Best HMM Match : Histone (HMM E-Value=5.1)
          Length = 157

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 74.1 bits (174), Expect = 9e-14
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT 366
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT 81


>SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6)
          Length = 128

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELL 309
           TVALREIRRYQKS + L
Sbjct: 46  TVALREIRRYQKSGDPL 62


>SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6)
          Length = 68

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 23/23 (100%), Positives = 23/23 (100%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPF 327
           TVALREIRRYQKSTELLIRKLPF
Sbjct: 46  TVALREIRRYQKSTELLIRKLPF 68


>SB_17103| Best HMM Match : Histone (HMM E-Value=0.65)
          Length = 97

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 47/51 (92%), Positives = 48/51 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEA 411
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A  ALQEA
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSARMALQEA 96


>SB_15200| Best HMM Match : Histone (HMM E-Value=0.22)
          Length = 97

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 47/51 (92%), Positives = 49/51 (96%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEA 411
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA 96


>SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 296

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 47/53 (88%), Positives = 49/53 (92%)
 Frame = +1

Query: 277 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           IRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 2   IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 54



 Score = 74.5 bits (175), Expect = 7e-14
 Identities = 35/39 (89%), Positives = 37/39 (94%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*ISLI 547
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  +L+
Sbjct: 53  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERAMSTLV 91


>SB_14580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 36/37 (97%), Positives = 37/37 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVK 233
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVK
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK 37


>SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 35/54 (64%), Positives = 47/54 (87%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           AL+EIR+ QKSTELLI+K+PFQRLVREI+Q+++ DL F   A+ ALQEA+EA++
Sbjct: 86  ALKEIRKLQKSTELLIKKVPFQRLVREISQNYRLDLRFHPDALLALQEATEAFI 139



 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 25/31 (80%), Positives = 28/31 (90%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           G+F+D NLCAIHAKRVTIMPKD+ LA RIRG
Sbjct: 141 GVFDDVNLCAIHAKRVTIMPKDLHLALRIRG 171


>SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07)
          Length = 55

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 22  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 55


>SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08)
          Length = 46

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 13  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46


>SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08)
          Length = 46

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 13  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46


>SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07)
          Length = 407

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 374 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 407


>SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08)
          Length = 46

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 13  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46


>SB_31724| Best HMM Match : Histone (HMM E-Value=4.8e-18)
          Length = 150

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/24 (75%), Positives = 21/24 (87%)
 Frame = -3

Query: 489 GMMVTRLA*IAHKLVSSNKPXEIS 418
           GMMVTRLA +AHKLVSSN+P  I+
Sbjct: 10  GMMVTRLAWMAHKLVSSNRPTSIA 33


>SB_49221| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 31

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = -3

Query: 489 GMMVTRLA*IAHKLVSSNKP 430
           GMMVTRLA +AHKLVSSN+P
Sbjct: 10  GMMVTRLAWMAHKLVSSNRP 29


>SB_32303| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 979

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = -3

Query: 450 LVSSNKPXEISLACLLESSDGGRLEXQISFEILSDFSHKTLERQLTDKQLSRL 292
           +VS   P  +S+   L+S+ G   E  +  EILSD + + + +   +KQL +L
Sbjct: 49  VVSGLMPLMVSVLEQLDSAYGDNNEQLVELEILSDDNEQLITQYEREKQLRKL 101


>SB_46905| Best HMM Match : WD40 (HMM E-Value=8.9e-12)
          Length = 340

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRR--YQKSTELL 309
           NK+P   L++K RV  ++    +  +   V  RSH  +      L+ I +  YQ + E L
Sbjct: 270 NKIPKETLDLKTRVRTIMVDNDQKTKATAVSKRSHEDLIEDVQQLKRINQNFYQFAVEEL 329

Query: 310 IRKL 321
           + ++
Sbjct: 330 MAEV 333


>SB_41851| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 967

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 181  NLLQKRRENQRRALVESRSHIVIALXTV 264
            NLLQ  R N +R +VESR  +V+ +  V
Sbjct: 931  NLLQHLRSNGKRLIVESREVVVVVVVVV 958


>SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15)
          Length = 458

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 15/38 (39%), Positives = 19/38 (50%)
 Frame = +3

Query: 144 ARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           A K+TGG    K   T A+ K+ P+T G  K  R   G
Sbjct: 141 AAKATGGIKENKSNKTTASIKNVPTTNGPSKTSRSTDG 178


>SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1203

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 142  LPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIRKL 321
            LP N      R+N+L++K  +     L ++   I+       +  I R Q +T      +
Sbjct: 768  LPKNHNGTLKRLNHLVKKLEKTPE--LYDACKEIIREQEEEGI--IERAQTATHGREFYI 823

Query: 322  PFQRLVREIAQDFKTDLXFQSAA 390
            PF+ +VRE+A+  KT L + ++A
Sbjct: 824  PFKPIVRELAESTKTRLVYDASA 846


>SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1097

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 16/70 (22%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = +1

Query: 91  LTCEKH*KSKQWLVLNKLPVNLLEVKLRVNNLLQKRR--ENQRRALVESRSHIVIALXTV 264
           +T +++ ++++     K PV+++    R++     +   +N+R  LV   S +++A  TV
Sbjct: 130 MTVDEYFRTRKGSKRRKTPVHIVGKPRRISRRSPPQHIDKNERERLVNMASKLIVATETV 189

Query: 265 ALREIRRYQK 294
           AL + +   K
Sbjct: 190 ALPQQKMQSK 199


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,584,650
Number of Sequences: 59808
Number of extensions: 290289
Number of successful extensions: 835
Number of sequences better than 10.0: 72
Number of HSP's better than 10.0 without gapping: 699
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 831
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1669334250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -