SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30)          73   1e-13
SB_15491| Best HMM Match : zf-C3HC4 (HMM E-Value=0.079)                31   0.78 
SB_9671| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   1.0  
SB_49816| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_9755| Best HMM Match : Sushi (HMM E-Value=0)                        29   3.1  
SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_44946| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_31611| Best HMM Match : Peptidase_M16_C (HMM E-Value=0.0021)        28   4.1  
SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.6  
SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.6  

>SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30)
          Length = 92

 Score = 72.9 bits (171), Expect = 1e-13
 Identities = 34/61 (55%), Positives = 43/61 (70%)
 Frame = +3

Query: 267 IFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRIAAQ 446
           I  GRK  G  PSHF   S S+AR  L+ LE +KLVEK   GGR +T+QG+RD+DRIA+Q
Sbjct: 32  IRAGRKNRGSAPSHFEVGSASVARSVLKGLEQIKLVEKASTGGRNITSQGQRDMDRIASQ 91

Query: 447 V 449
           +
Sbjct: 92  I 92



 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 17/26 (65%), Positives = 23/26 (88%)
 Frame = +2

Query: 107 TGKVKVPEHMDLVKTARFKELAPYDP 184
           +G +K+P+ +DLVKT +FKELAPYDP
Sbjct: 2   SGNLKIPDWVDLVKTGKFKELAPYDP 27


>SB_15491| Best HMM Match : zf-C3HC4 (HMM E-Value=0.079)
          Length = 689

 Score = 30.7 bits (66), Expect = 0.78
 Identities = 18/78 (23%), Positives = 30/78 (38%)
 Frame = +2

Query: 113 KVKVPEHMDLVKTARFKELAPYDPXLVLCALCCHPSSYLHSLTCWSKDCHQDLWWAQT*W 292
           K++ P H  L +      +A +    + C +CC     L  L C  + CH    W    W
Sbjct: 161 KIRTPAHT-LSQVTMTNNMADH----MTCIICCEGDDELELLPCCKQPCHYPCLWK---W 212

Query: 293 SYTFTFLQVIRQYCTQGF 346
            +     +    +C +GF
Sbjct: 213 VHAHLTPRSTCPHCRKGF 230


>SB_9671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 248

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +2

Query: 194 LCALCCHPSSYLHSLTCWSKDCHQ 265
           LC+  C   S+ H+LTC ++ CHQ
Sbjct: 99  LCSQSCVWESHCHALTCTARICHQ 122


>SB_49816| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +3

Query: 330 IARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRIAAQV 449
           IA   LQ   A+  V ++     +++T GRR+LDR  A++
Sbjct: 80  IAPNGLQYCVAMMAVSRIGACAVLMSTSGRRELDRFTAEL 119


>SB_9755| Best HMM Match : Sushi (HMM E-Value=0)
          Length = 1351

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = +2

Query: 305 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 397
           TF   ++  C +GF ++G      +S+G+WS
Sbjct: 21  TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 51


>SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 455

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = +2

Query: 305 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 397
           TF   ++  C +GF ++G      +S+G+WS
Sbjct: 286 TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 316



 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +2

Query: 305 TFLQVIRQYCTQGFAIVGG-IEAC*ESSGRWS 397
           TF   +   C +GF ++G  + +C +SSG+WS
Sbjct: 112 TFPNKVTFSCDEGFILIGSPLRSC-QSSGKWS 142


>SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 346

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +1

Query: 58  C*TRQDC*NCRCSLKKNGQSQGT*AHGSCKDSSLQRAGSV 177
           C   QDC + RC  +KNG  + T A G CK S    + ++
Sbjct: 301 CNCMQDCSSSRCFWRKNG-IECTPACGQCKGSDCTNSPAI 339


>SB_44946| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 18/60 (30%), Positives = 28/60 (46%)
 Frame = +3

Query: 192 FYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKL 371
           +YVR A +     I +  G   + +I   R+R  VTPS    S G    + L  L+ ++L
Sbjct: 59  WYVRDACVSPSENISTNYGSPKLPRIVETRQRGDVTPSPLVLSRGISRERLLTKLDRMQL 118


>SB_31611| Best HMM Match : Peptidase_M16_C (HMM E-Value=0.0021)
          Length = 398

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +2

Query: 80  KTVAAHLKKT--GKVKVPEHMDLVKTARFKELAP-YDPXLVLCALCCHPS 220
           K+V++ L +    KV      DL +  + + LAP +DP    CA+CC+PS
Sbjct: 268 KSVSSWLARDLLNKVSQVTMSDLERVGQ-RYLAPLFDPVTSWCAVCCNPS 316


>SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2988

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 5/31 (16%)
 Frame = +2

Query: 200 ALCCHPS-SYLHSLTCWS----KDCHQDLWW 277
           A  CH + +YLH++TC++    K  H D +W
Sbjct: 374 AFLCHATFAYLHAVTCYNTSFVKGEHMDYYW 404


>SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1048

 Score = 27.1 bits (57), Expect = 9.6
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +2

Query: 305  TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWSHSHHT 412
            T+   I   C +G+A++G      +++G WS S+ T
Sbjct: 913  TYSSTINITCDEGYALIGPESRVCQANGTWSGSNVT 948


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,986,815
Number of Sequences: 59808
Number of extensions: 323874
Number of successful extensions: 762
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 691
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 762
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1197191618
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -