SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45)    31   0.54 
SB_57482| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)             29   2.2  
SB_30463| Best HMM Match : ZF-HD_dimer (HMM E-Value=5.4)               28   6.6  
SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  

>SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45)
          Length = 4160

 Score = 31.5 bits (68), Expect = 0.54
 Identities = 19/93 (20%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +1

Query: 151 VDQMRQILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFN 330
           ++   +++ ++ + L +P    K +  K     E+L++  ++    + I+    +    +
Sbjct: 76  LENQDELIKQLREGLRNPKVKEKSENTKLNKEREILELKGVINQHEINIKQLQQELENSH 135

Query: 331 NSREGIVQFTQLIR-DLESIDGEVARLHTQIRS 426
            S E + Q     R DL++ D  +ARL+ +I S
Sbjct: 136 QSHEQLHQHYACARGDLDARDSTIARLYREINS 168


>SB_57482| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)
          Length = 789

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 11/17 (64%), Positives = 12/17 (70%)
 Frame = +3

Query: 396 GCPSSYSNPKPLPAPCV 446
           GCPS+ S P P PAP V
Sbjct: 703 GCPSTTSTPAPAPAPAV 719


>SB_30463| Best HMM Match : ZF-HD_dimer (HMM E-Value=5.4)
          Length = 276

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -2

Query: 312 YCLHFYLHNHGEDY 271
           YCL FYLH  GE Y
Sbjct: 108 YCLQFYLHKSGEIY 121


>SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 228

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -2

Query: 312 YCLHFYLHNHGEDY 271
           YCL FYLH  GE Y
Sbjct: 108 YCLQFYLHKSGEIY 121


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,278,456
Number of Sequences: 59808
Number of extensions: 340059
Number of successful extensions: 867
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 705
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 867
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1451595000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -