SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07)          56   1e-08
SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06)                 30   0.88 
SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58)                      29   2.7  
SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31)               29   2.7  
SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.)                28   3.6  
SB_36327| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.7  
SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15)                   27   6.2  
SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.2  
SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.2  
SB_50855| Best HMM Match : Ras (HMM E-Value=0)                         27   8.2  

>SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07)
          Length = 58

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 26/44 (59%), Positives = 31/44 (70%)
 Frame = +1

Query: 202 RPAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIV 333
           RP +   +   +KTV R YGG  C  CVK+RI+RAFLIEEQKIV
Sbjct: 2   RPMKLMHISKPQKTVSRAYGGSRCAACVKERIIRAFLIEEQKIV 45


>SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06)
          Length = 299

 Score = 30.3 bits (65), Expect = 0.88
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +3

Query: 48  IQATTVVQHKIKSKKNSKDTGWPLGLSV 131
           I     VQH  K+KK + DT +P+G++V
Sbjct: 45  ISGEYAVQHSCKNKKETIDTDYPIGMAV 72


>SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58)
          Length = 429

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +1

Query: 55  RRLSYNTKSNQRRIVRTPGGRLVYQYVKKP 144
           RR++  T SN  R++RTP G+ ++  VK P
Sbjct: 159 RRITKTTNSNSTRLIRTP-GQSIHIKVKAP 187


>SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31)
          Length = 690

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +3

Query: 9   PAVKKLENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCKKAQEDPKVWSVQEQTPW 188
           P VK+    ++AYI  T+  + K+K+K     T  P    V K A E+ K  + +++ P+
Sbjct: 494 PVVKR---ASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPY 550


>SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 673

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -2

Query: 291 LLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEFALALTTPW 154
           L+D  + + +  +  HCF+T+  T T ++ S   T  F L   +PW
Sbjct: 542 LIDELVKQSSCPSRAHCFITMTTTQTSTKISIAPTNTFFL---SPW 584


>SB_36327| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 409

 Score = 27.9 bits (59), Expect = 4.7
 Identities = 14/53 (26%), Positives = 27/53 (50%)
 Frame = +1

Query: 181 LRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKV 339
           ++G++  R  + S  C R   V +VY   +C +C +   V+   + E ++ KV
Sbjct: 201 VKGVRDVRVNKVSERCLRGACVYKVYERCVCTRCTRGACVQG--LREVRVYKV 251


>SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15)
          Length = 857

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +3

Query: 237 ENSETCLWWCPLP*MCQATHCQSLPH*RTKNCEGPQGTT 353
           ++ +  LW  P+P   Q + C+S P   T   E P  TT
Sbjct: 223 KHPDLMLWRKPVPKTDQQSECESSPGANTDRLESPARTT 261


>SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 42

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = -1

Query: 136 LHTDKPSGHPVSLLFFFDLI 77
           LHT +P+GHP  ++  FD I
Sbjct: 5   LHTTEPTGHPCHIVCCFDAI 24


>SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1333

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +3

Query: 279 MCQATHCQSLPH*RTKNCEGPQGTTGEH*VGKEGYKVNFR 398
           +CQ  HC  LP  R K+C+ P   TG     ++ Y+   R
Sbjct: 115 VCQDDHCACLPCWRGKSCDQPD-LTGPPEFEQKEYEAEIR 153


>SB_50855| Best HMM Match : Ras (HMM E-Value=0)
          Length = 733

 Score = 27.1 bits (57), Expect = 8.2
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = -2

Query: 300 DNALLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEF 178
           DN LL    +  T +N    FL + K G   +   L+ TEF
Sbjct: 155 DNGLLFMETSAKTAMNVNDIFLAIGKKGKKKKGKTLNLTEF 195


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,545,864
Number of Sequences: 59808
Number of extensions: 263777
Number of successful extensions: 766
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 704
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 766
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1026164244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -