SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_19257| Best HMM Match : No HMM Matches (HMM E-Value=.)             313   7e-86
SB_42692| Best HMM Match : Ribosomal_L2_C (HMM E-Value=4.9e-05)       210   6e-55
SB_43058| Best HMM Match : Ribosomal_L2_C (HMM E-Value=8.26766e-44)    56   3e-08
SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13)                   31   0.83 
SB_39055| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.)                29   3.3  
SB_50959| Best HMM Match : Exo_endo_phos (HMM E-Value=8.7e-05)         29   4.4  
SB_40024| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0088)          29   4.4  
SB_31666| Best HMM Match : Exo_endo_phos (HMM E-Value=7.6e-05)         29   4.4  
SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0)                       29   4.4  
SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.4  
SB_5691| Best HMM Match : Exo_endo_phos (HMM E-Value=7.5e-05)          29   4.4  

>SB_19257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 260

 Score =  313 bits (769), Expect = 7e-86
 Identities = 143/190 (75%), Positives = 163/190 (85%)
 Frame = +3

Query: 87  FSFLTRRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKE 266
           F+  T+ R K   N  +  YAERHGYIKGVVK+IIHDPGRGAPLAVV FRDPY++K RKE
Sbjct: 16  FTSHTKHR-KGAANLRVHDYAERHGYIKGVVKEIIHDPGRGAPLAVVVFRDPYRYKLRKE 74

Query: 267 LFIAPEGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFA 446
           LF+A EG+YTGQF+YCGKKA L++GN +PVG MPEGTI+ ++EEK GDRGRLAR SGN+A
Sbjct: 75  LFVATEGMYTGQFIYCGKKAALQIGNCLPVGIMPEGTIISSVEEKTGDRGRLARTSGNYA 134

Query: 447 TVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRN 626
           TVI HN + KRTRVKLPSG KKV+PSSNR +VGIVAGGGRIDKP+LKAGRAYHKYK KRN
Sbjct: 135 TVISHNVEKKRTRVKLPSGIKKVIPSSNRALVGIVAGGGRIDKPMLKAGRAYHKYKAKRN 194

Query: 627 CWPYVRGVAM 656
           CWP VRGVAM
Sbjct: 195 CWPRVRGVAM 204



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLR 133
           QRKGAGS+F SHTK RKGA  LR
Sbjct: 8   QRKGAGSIFTSHTKHRKGAANLR 30


>SB_42692| Best HMM Match : Ribosomal_L2_C (HMM E-Value=4.9e-05)
          Length = 123

 Score =  210 bits (514), Expect = 6e-55
 Identities = 93/123 (75%), Positives = 109/123 (88%)
 Frame = +3

Query: 171 GVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVM 350
           GVVK+IIHDPGRGAPLAVV FRDPY++K RKELF+A EG+YTGQF+YCGKKA L++GN +
Sbjct: 1   GVVKEIIHDPGRGAPLAVVVFRDPYRYKLRKELFVATEGMYTGQFIYCGKKAALQIGNCL 60

Query: 351 PVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSN 530
           PVG MPEGTI+ ++EEK GDRGRLAR SGN+ATVI HN + KRTRVKLPSG KKV+PSSN
Sbjct: 61  PVGIMPEGTIISSVEEKTGDRGRLARTSGNYATVISHNVEKKRTRVKLPSGIKKVIPSSN 120

Query: 531 RGM 539
           R +
Sbjct: 121 RAL 123


>SB_43058| Best HMM Match : Ribosomal_L2_C (HMM E-Value=8.26766e-44)
          Length = 222

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 49/149 (32%), Positives = 75/149 (50%), Gaps = 5/149 (3%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYC--GKK---AT 329
           IK  V  + +DP R A +A+V          +++L IAP+ +  G  +    GK    A 
Sbjct: 56  IKDKVLQVGYDPCRSARIALVAGNG----SNQEKLVIAPDEIQVGDVMTASRGKPESLAL 111

Query: 330 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 509
           L+ G+  P+  +P GT+V N+E   G   +LARA+G  A +I    +     V+LPS  +
Sbjct: 112 LKPGDAYPLCFLPIGTVVHNIELYPGKGAQLARAAGTSAQLIRKTNET--AVVRLPSKVE 169

Query: 510 KVLPSSNRGMVGIVAGGGRIDKPILKAGR 596
           K + S     VG V+   R ++ I KAGR
Sbjct: 170 KEVSSKCLASVGRVSNIERKNRVIGKAGR 198


>SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13)
          Length = 1819

 Score = 31.1 bits (67), Expect = 0.83
 Identities = 14/25 (56%), Positives = 16/25 (64%)
 Frame = -2

Query: 559 PPATIPTMPLLLDGRTFLAPDGSFT 485
           P AT   + L+LD  TFL PDGS T
Sbjct: 135 PAATTTYLNLILDSETFLEPDGSAT 159


>SB_39055| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 448

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 2/76 (2%)
 Frame = -1

Query: 479 TLSIRIVSNHSGEVSRGTCQTTSITHFLFKIAHNG--TLRHSSNRHHISNFKSCFLSTIN 306
           T SI ++ + +   + GTC+     +  FK+ H     + H  + H ++N   C +  ++
Sbjct: 76  THSILVLLSAAACAANGTCEEPRRRNTFFKLKHKDRMLIDHVISSHDVTNPIHCSMECLS 135

Query: 305 KLACVEPFGSNEELLP 258
              CV  F   +++ P
Sbjct: 136 NQRCVS-FNLKKQITP 150


>SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2323

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)
 Frame = +3

Query: 420  LARASGNF--ATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMVGI 548
            +AR +G+F   T +    D  RTR   P   KKVL ++N G + I
Sbjct: 1469 IARRTGSFDNLTSMLRLQDTPRTRTLAPISVKKVLTATNPGQLAI 1513


>SB_50959| Best HMM Match : Exo_endo_phos (HMM E-Value=8.7e-05)
          Length = 275

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = -1

Query: 623 TFDLVLVVCPSSFQNRFVNTSTSSNNTDHASVA*WQNLLGSR 498
           T DL+L   P    N  VNTST+S  +DH +V    NL  SR
Sbjct: 192 TLDLLLTTYP----NVIVNTSTASGLSDHLAVIFEVNLKPSR 229


>SB_40024| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0088)
          Length = 321

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = -1

Query: 623 TFDLVLVVCPSSFQNRFVNTSTSSNNTDHASVA*WQNLLGSR 498
           T DL+L   P    N  VNTST+S  +DH +V    NL  SR
Sbjct: 144 TLDLLLTTYP----NVIVNTSTASGLSDHLAVIFEVNLKPSR 181


>SB_31666| Best HMM Match : Exo_endo_phos (HMM E-Value=7.6e-05)
          Length = 249

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = -1

Query: 623 TFDLVLVVCPSSFQNRFVNTSTSSNNTDHASVA*WQNLLGSR 498
           T DL+L   P    N  VNTST+S  +DH +V    NL  SR
Sbjct: 192 TLDLLLTTYP----NVIVNTSTASGLSDHLAVIFEVNLKPSR 229


>SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 801

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = -1

Query: 623 TFDLVLVVCPSSFQNRFVNTSTSSNNTDHASVA*WQNLLGSR 498
           T DL+L   P    N  VNTST+S  +DH +V    NL  SR
Sbjct: 86  TLDLLLTTYP----NVIVNTSTASGLSDHLAVIFEVNLKPSR 123


>SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1304

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = -2

Query: 400  FSSRLHTMVPSGIAPTGITFPTSRVAFFPQ*TNWPV*SPSGAMKSSFLVLNLYGSRKCTT 221
            F+S L T +P+   P G+TF T +V F    +NW + + SG + +   ++ +  S +   
Sbjct: 1067 FNSELVTSLPT---PPGLTFTTYKVVFLE--SNWRIGNTSGRVATDKELVRVLSSLEYLW 1121

Query: 220  AKG 212
             +G
Sbjct: 1122 IRG 1124


>SB_5691| Best HMM Match : Exo_endo_phos (HMM E-Value=7.5e-05)
          Length = 273

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = -1

Query: 623 TFDLVLVVCPSSFQNRFVNTSTSSNNTDHASVA*WQNLLGSR 498
           T DL+L   P    N  VNTST+S  +DH +V    NL  SR
Sbjct: 192 TLDLLLTTYP----NVIVNTSTASGLSDHLAVIFEVNLKPSR 229


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,159,073
Number of Sequences: 59808
Number of extensions: 492096
Number of successful extensions: 1231
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1230
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1681430875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -