SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6)                      32   0.47 
SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.62 
SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.1  
SB_664| Best HMM Match : No HMM Matches (HMM E-Value=.)                31   1.1  
SB_49185| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.4  
SB_26573| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.4  
SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05)                 29   4.4  
SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048)                    29   4.4  
SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28)                   28   5.8  
SB_59294| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.20004e-41)    28   5.8  
SB_48894| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.8  
SB_2798| Best HMM Match : DNA_pol_B_2 (HMM E-Value=7.9e-10)            28   5.8  
SB_36951| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  
SB_8375| Best HMM Match : NUC153 (HMM E-Value=2.9)                     28   7.6  
SB_41314| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  

>SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6)
          Length = 235

 Score = 31.9 bits (69), Expect = 0.47
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +2

Query: 134 PVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILH 313
           PVY + N+++VP   +  S  PG L  LL  S     + YN Q ++ ++ + V  A ++ 
Sbjct: 31  PVYEVNNIESVPFPGIISS--PGDLFPLLPDSIR---FIYNAQISKCEEHLSVKLAHLMS 85

Query: 314 LI 319
           L+
Sbjct: 86  LV 87


>SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 359

 Score = 31.5 bits (68), Expect = 0.62
 Identities = 19/72 (26%), Positives = 38/72 (52%)
 Frame = +2

Query: 200 GGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQEKGGKLKVFEL 379
           G  +RLL+GS +  V  Y+LQ  +V   +    +PIL L  +D  ++++++   L  ++ 
Sbjct: 242 GAYKRLLSGSIDRNVKVYDLQDYKVVHSMDY-PSPILSLAVSDDVVVSEKRKTYLNKYDK 300

Query: 380 TNSGYEEDAVIE 415
               +E  A ++
Sbjct: 301 LVKNFEYAAALD 312


>SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2653

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +2

Query: 344  QEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASL-YVPEKDYKINIYNFNGE 520
            QE+GG+L +  L +S        ++DY    RF   TKLA+  Y+PE   K+ I NF   
Sbjct: 1793 QEQGGRLLI-RLGDS--------DIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVT 1843

Query: 521  KLG 529
            K G
Sbjct: 1844 KSG 1846


>SB_664| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1046

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 2/93 (2%)
 Frame = +2

Query: 194 LPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQE--KGGKLK 367
           L GG+  +++G K GYVY    +   + Q         + + HT  H IT++  +   ++
Sbjct: 273 LLGGMCVMVSGPKEGYVYDIYNKAMLLSQYKYTSDTIKVSVCHTLLHAITKQGLETYTVR 332

Query: 368 VFELTNSGYEEDAVIEVDYPGFCRFEANTKLAS 466
           ++   + G   D V++ +       +  +K+AS
Sbjct: 333 MYAAASQGLRTDRVLQHNLSSMQNEKKESKIAS 365


>SB_49185| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 371

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = -3

Query: 600 HGNSMNFRHITSPSFTDASSYSKEPSFSPLKL 505
           +G S++F   TSP + D ++  +EPS +P  L
Sbjct: 112 YGGSISFEDETSPRYYDNNNTYEEPSLTPAAL 143


>SB_26573| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 86

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -3

Query: 630 RNQLVXQGLSHGNSMNFRHITSPSF-TDASSYSKEPSFSP-LKL*MFIL*SFSGT*SDAS 457
           RN+ + QG+S G+  N  H  + SF + A++ +++  F P +K+   IL S  G   D  
Sbjct: 23  RNKDLGQGVSLGDDYNIAHWVNHSFYSSANAKTQQDEFVPRIKVPDVILNSIGGDVQDNP 82

Query: 456 F 454
           F
Sbjct: 83  F 83


>SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05)
          Length = 1023

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -3

Query: 630 RNQLVXQGLSHGNSMNFRHITSPSF-TDASSYSKEPSFSP-LKL*MFIL*SFSGT*SDAS 457
           RN+ + QG+S G+  N  H  + SF + A++ +++  F P +K+   IL S  G   D  
Sbjct: 153 RNKDLGQGVSLGDDYNIAHWVNHSFYSSANAKTQQDEFVPRIKVPDVILNSIGGDVQDNP 212

Query: 456 F 454
           F
Sbjct: 213 F 213


>SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048)
          Length = 1952

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = -3

Query: 600  HGNSMNFRHITSPSFTDASSYSKEPSFSPLKL 505
            +G S++F   TSP + D ++  +EPS +P  L
Sbjct: 1693 YGGSISFEDETSPRYYDNNNTYEEPSLTPAAL 1724


>SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28)
          Length = 539

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 2/93 (2%)
 Frame = +2

Query: 290 VGQAPILHLIHT-DSHLITQEKGGKLKVFEL-TNSGYEEDAVIEVDYPGFCRFEANTKLA 463
           VG    +H + T  +HLI+ ++G  LKV+++ T   Y E       +   C    +T L 
Sbjct: 92  VGHDKDVHCLLTFGAHLISVDEGSSLKVWDIKTTELYLEVGFDSKTFHITCLMHPSTYLN 151

Query: 464 SLYVPEKDYKINIYNFNGEKLGSLEYDDASVKL 562
            + +  K   + I+N         +YD+A+V +
Sbjct: 152 KILLCSKQGSMQIWNI------KTKYDNATVNV 178


>SB_59294| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.20004e-41)
          Length = 851

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +2

Query: 467 LYVPE-KDYKINIYNFNGEKLGSLEYDDASVKLGDVMCLKFIEFPCDRPXSTSWL 628
           ++V E KD + ++  F  E L S  Y D  ++   ++CL +I    DR  + +WL
Sbjct: 624 MFVDEFKDAEFHLRRFESEPLPSQTYKDFLLQFQKMVCLDYIIRNTDR-GNDNWL 677


>SB_48894| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +3

Query: 120 ASSGILFTLSEMSIMCQFIHWLSVFYP 200
           ASSG+    S++ I CQ + WL   YP
Sbjct: 44  ASSGVSSRASDIHIGCQIVWWLDDRYP 70


>SB_2798| Best HMM Match : DNA_pol_B_2 (HMM E-Value=7.9e-10)
          Length = 1378

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 13/52 (25%), Positives = 19/52 (36%)
 Frame = +1

Query: 109 KMALLPPXSCLHYPKCR*CASLFTGFQFFTRGLREVTSRFEKRLCLRIQPPD 264
           K  + P   C  Y KC  C            G+  V   ++  +C  + PPD
Sbjct: 465 KKNVTPRSYCQMYHKCEACGKRIDMVAIQKEGVSHVCGEYKCTVCKEVVPPD 516


>SB_36951| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 103

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/27 (40%), Positives = 20/27 (74%)
 Frame = +2

Query: 329 SHLITQEKGGKLKVFELTNSGYEEDAV 409
           +HLI QE+   L++ EL ++ Y++DA+
Sbjct: 12  AHLIKQEEKVNLELRELQHTAYDDDAI 38


>SB_8375| Best HMM Match : NUC153 (HMM E-Value=2.9)
          Length = 433

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -1

Query: 287 VSSAELYLSGGCMRKHNRFSNRLVTSLSPRVKN*KPVNKLAHYRH 153
           ++S   +L  GC    N+F N L TS+   +   K +NKL  ++H
Sbjct: 89  MASINTHLDSGC----NKFGNELNTSIKSGIGVEKRINKLDVHKH 129


>SB_41314| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1388

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 13/52 (25%), Positives = 18/52 (34%)
 Frame = +1

Query: 109 KMALLPPXSCLHYPKCR*CASLFTGFQFFTRGLREVTSRFEKRLCLRIQPPD 264
           K  + P   C  Y KC  C            G   V   ++  +C  + PPD
Sbjct: 475 KKNVTPRSYCQMYHKCETCGKRIDMIAIQKEGTSHVCGEYKCTVCKEVVPPD 526


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,058,569
Number of Sequences: 59808
Number of extensions: 341394
Number of successful extensions: 748
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 695
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 747
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1669334250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -