SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37831| Best HMM Match : MAM (HMM E-Value=0)                         30   0.63 
SB_8910| Best HMM Match : MAM (HMM E-Value=1.9)                        30   0.63 
SB_45686| Best HMM Match : T-box (HMM E-Value=0)                       27   4.5  

>SB_37831| Best HMM Match : MAM (HMM E-Value=0)
          Length = 563

 Score = 30.3 bits (65), Expect = 0.63
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +2

Query: 113 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 223
           G  G + Q  QV + + GET + ++  V+G    GDI
Sbjct: 151 GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 187


>SB_8910| Best HMM Match : MAM (HMM E-Value=1.9)
          Length = 89

 Score = 30.3 bits (65), Expect = 0.63
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +2

Query: 113 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 223
           G  G + Q  QV + + GET + ++  V+G    GDI
Sbjct: 22  GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 58


>SB_45686| Best HMM Match : T-box (HMM E-Value=0)
          Length = 947

 Score = 27.5 bits (58), Expect = 4.5
 Identities = 18/36 (50%), Positives = 20/36 (55%)
 Frame = -1

Query: 259 PPSFTFRFKKSEDVSVTDGSFHVSDDLTAGLPNELD 152
           P S   RFK SED   T  SF  SD++  G P ELD
Sbjct: 568 PSSSPKRFKTSEDEEPTAQSFE-SDEI-PGSPEELD 601


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,182,957
Number of Sequences: 59808
Number of extensions: 224495
Number of successful extensions: 554
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 501
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 551
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 740151420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -