SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A12
         (413 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_25594| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.38 
SB_59781| Best HMM Match : Neur_chan_LBD (HMM E-Value=0)               28   3.5  
SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.5  
SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.1  
SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.1  

>SB_25594| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1084

 Score = 31.1 bits (67), Expect = 0.38
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 2/46 (4%)
 Frame = +2

Query: 74  SLTCTARGNARPATASSTLRTM--LQXQLVIADVDPATGRAADTSK 205
           SL+  ARG A   TA S + T+   + +++ A++DP TG+ A  SK
Sbjct: 241 SLSSVARGVAGHHTAESIVETINRAESKILTAELDPLTGKIALMSK 286


>SB_59781| Best HMM Match : Neur_chan_LBD (HMM E-Value=0)
          Length = 275

 Score = 27.9 bits (59), Expect = 3.5
 Identities = 17/70 (24%), Positives = 28/70 (40%), Gaps = 3/70 (4%)
 Frame = +2

Query: 29  YRVDVHIKCRTTPVNSLTC---TARGNARPATASSTLRTMLQXQLVIADVDPATGRAADT 199
           Y V++ I C    V SL     +     R     + L  +    L++AD+ P T      
Sbjct: 205 YWVNLIIPCMLITVLSLLSFIVSTDSGERVGLVITDLLALTVFMLIVADILPPTSEVVPV 264

Query: 200 SKMYVVCGAI 229
             +Y++C  I
Sbjct: 265 ISIYIICSTI 274


>SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2353

 Score = 27.9 bits (59), Expect = 3.5
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = -2

Query: 115 GCWPSISSGSTSQRIHRRRSAFYMYVHT 32
           G W +  + S   R+H+RR+A ++Y  T
Sbjct: 337 GIWHTRRTSSRGIRLHKRRNAMFVYAKT 364


>SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1080

 Score = 27.1 bits (57), Expect = 6.1
 Identities = 10/48 (20%), Positives = 23/48 (47%)
 Frame = +2

Query: 26  VYRVDVHIKCRTTPVNSLTCTARGNARPATASSTLRTMLQXQLVIADV 169
           ++ V  H+  R  P+++  CTA    + +  + T+        ++AD+
Sbjct: 842 IHEVSRHLNTRAPPISARPCTAMSTTQQSKITKTITDAAVITGLVADI 889


>SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1211

 Score = 26.6 bits (56), Expect = 8.1
 Identities = 11/43 (25%), Positives = 20/43 (46%)
 Frame = -3

Query: 282 PSFFVNLTMQSSDSPILRIAPQTTYILDVSAARPVAGSTSAIT 154
           P   V ++ Q   +P + +AP+TT + + + A      T   T
Sbjct: 396 PEISVTISTQPKKAPGITVAPETTVVPETTVASETTAETHQTT 438


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,071,550
Number of Sequences: 59808
Number of extensions: 199411
Number of successful extensions: 526
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 443
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 526
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 764823134
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -