SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0)               89   1e-18
SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026)           62   2e-10
SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.2  
SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44)             27   5.6  
SB_25340| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55624| Best HMM Match : PHD (HMM E-Value=3.8)                       27   5.6  
SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037)                27   7.4  
SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)               27   9.7  
SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09)                 27   9.7  

>SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0)
          Length = 113

 Score = 89.4 bits (212), Expect = 1e-18
 Identities = 38/57 (66%), Positives = 43/57 (75%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KP+F         IVLR+EC  CK R Q+ LKRCKHFELGGDKKRKGQMIQF
Sbjct: 57  FGGQTKPVFHKKAKTTKKIVLRMECTQCKYRKQMPLKRCKHFELGGDKKRKGQMIQF 113



 Score = 27.5 bits (58), Expect = 5.6
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +1

Query: 136 GRTAKNVNATKYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           G+  +     K T+Y   K+ +     + +RRYDRKQ G     +    K+ K
Sbjct: 21  GKKCRRHTLHKVTQY---KTGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAK 70


>SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026)
          Length = 39

 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 26/33 (78%), Positives = 28/33 (84%)
 Frame = +2

Query: 308 IVLRLECADCKVRSQVALKRCKHFELGGDKKRK 406
           IVLR+EC  CK R Q+ LKRCKHFELGGDKKRK
Sbjct: 7   IVLRMECTQCKYRKQMPLKRCKHFELGGDKKRK 39


>SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1442

 Score = 27.9 bits (59), Expect = 4.2
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +2

Query: 320  LECADCKVRSQVALKRCKHFELG 388
            +EC +CK R  +A   C HF+ G
Sbjct: 1113 IECPNCKFRYDLAKGGCMHFKCG 1135


>SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44)
          Length = 251

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 17/59 (28%), Positives = 25/59 (42%)
 Frame = +2

Query: 224 EDVMIVNSRXYGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKK 400
           +D +I NS+    +SK  +         I   L C  C V   +A KRC+   +G   K
Sbjct: 106 DDSLIKNSQSE--ESKVFYNKIVLPTSNITTALNCKTCNVVYLIACKRCQKQYVGETSK 162


>SB_25340| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1105

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = +1

Query: 4  FACLNQTKKCQSVKCHCW 57
          F C+   K+C S  C CW
Sbjct: 41 FLCMRLLKRCHSCACACW 58


>SB_55624| Best HMM Match : PHD (HMM E-Value=3.8)
          Length = 349

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 164 QSTQGITVQ-KVQGKARCPGXEDVMIVNSRXYGGQSK 271
           Q+TQG   Q + +GKA C G  D  +V S   G  SK
Sbjct: 71  QTTQGGATQGEKEGKASCNGIADGEVVKSTVNGTASK 107


>SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037)
          Length = 303

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = -3

Query: 437 LEAFKIGSSVPFSSCHHRAQSACI 366
           +E + +G S+ +  C H   SACI
Sbjct: 261 MEEYAVGDSMKYLPCRHNFHSACI 284


>SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 931

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 11/32 (34%), Positives = 13/32 (40%)
 Frame = -1

Query: 217 WAACLSLDFLYCDTLCTLWHLHFLQYVLRCFG 122
           W     L F+ C TLC  W +    Y  R  G
Sbjct: 283 WIGAWWLGFVICGTLCIFWSIWLFGYPKRIPG 314


>SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)
          Length = 227

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 8/76 (10%)
 Frame = +1

Query: 49  HCWIKVSLFDV---C*YRAERTQKW*TYQNSAG-----RTAKNVNATKYTRYHSTKSPRK 204
           HC I   L  +   C Y  +RT+K  +  N  G     RT +   ++   + +S++ PR+
Sbjct: 57  HCSINQRLLTLETCCGYEYDRTRKSMSSPNFQGSSRAHRTPQEGESSLKRKENSSQGPRQ 116

Query: 205 GTLPRXRRRYDRKQQG 252
               R R R  R++QG
Sbjct: 117 RLRVRLRYRICRERQG 132


>SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 877

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +2

Query: 344 RSQVALKRCKHFELGGDKKR 403
           +S++A  RC H  LGGD +R
Sbjct: 495 QSRIASPRCAHRPLGGDSRR 514


>SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09)
          Length = 321

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = -2

Query: 417 IICPFLFLSPPSSKCLHLFNATCDLTLQSAHSR 319
           I+C   F +P  +KCLH F   C L     +S+
Sbjct: 246 IMCRKTFKNPVVTKCLHYFCEACALQHYKKNSK 278


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,703,580
Number of Sequences: 59808
Number of extensions: 272257
Number of successful extensions: 800
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 755
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 800
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 920703675
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -