SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.82 
SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5)           30   1.4  
SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.5  
SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4)                  29   3.3  
SB_44985| Best HMM Match : YhjQ (HMM E-Value=0.37)                     29   3.3  
SB_6351| Best HMM Match : IncA (HMM E-Value=0.13)                      29   3.3  
SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45)           29   4.4  
SB_43681| Best HMM Match : MAM (HMM E-Value=2.5e-20)                   28   7.6  
SB_24027| Best HMM Match : FAD_binding_7 (HMM E-Value=0)               28   7.6  
SB_22216| Best HMM Match : PGAMP (HMM E-Value=4)                       28   7.6  
SB_16395| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.6  

>SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 512

 Score = 31.1 bits (67), Expect = 0.82
 Identities = 21/70 (30%), Positives = 34/70 (48%)
 Frame = -3

Query: 405 FARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYEHYIGSNLVHF 226
           F +G   L + V    ++GLEL  +I+ ++D++ S        CL +E   +   N   F
Sbjct: 56  FFQGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACLPSEVPAF--CNTERF 113

Query: 225 GELLTDLGLA 196
           G LL D+  A
Sbjct: 114 GLLLVDVRCA 123


>SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5)
          Length = 585

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 24/76 (31%), Positives = 39/76 (51%)
 Frame = +3

Query: 180 RKTNRQQDRDP*EARQNVQGYSRCSVRIRFQDKLRRWQVNWIRFDLRHTRSGQEVRAQAQ 359
           R+T++  DR    A+ NV   S   V++R  D ++   V+ ++ D R + SGQ+V   ++
Sbjct: 281 RRTSQSNDR----AQGNVTVVSTAHVQVRADD-VQAMNVSGVKSDGRPSSSGQDVYDGSR 335

Query: 360 VSPPRPVREEEAHAQT 407
            S   P    E  AQT
Sbjct: 336 QSTHGPALPWEELAQT 351


>SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = -3

Query: 252 YIGSNLVHFGELLTDLGLADGWFSWM*NIANHLLARQQSVGHELASANS 106
           +I  N  +F   + DLG+A  +   +  + +H L R Q+VGH  A   S
Sbjct: 289 FIDFNDFYFSNRVVDLGIALAYIMMLPQVNSH-LTRPQAVGHMFAGYQS 336


>SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4)
          Length = 166

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +1

Query: 352 KHRLARHGLYEKKRPTRKQRKERKNRMKKVR 444
           +H LA H   +++RP+   R+  K R++K+R
Sbjct: 79  RHGLASHDKKKRERPSLVARERMKKRLRKIR 109


>SB_44985| Best HMM Match : YhjQ (HMM E-Value=0.37)
          Length = 1376

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 325  LDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKV 441
            LDL      KHR  RH   EKK    K RK +KN M+++
Sbjct: 1000 LDLLLAHATKHRGRRHRS-EKKEKANKARKCQKNYMRRL 1037


>SB_6351| Best HMM Match : IncA (HMM E-Value=0.13)
          Length = 417

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +1

Query: 352 KHRLARHGLYEKKRPTRKQRKERKNRMKKVR 444
           +H LA H   +++RP+   R+  K R++K+R
Sbjct: 378 RHGLASHDKKKRERPSLVARERMKKRLRKIR 408


>SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45)
          Length = 527

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = -3

Query: 153 LARQQSVGHELASANSRCSFTHFELFSIIRRLHARVSAKTREKERV 16
           +AR+  +  E  S   RC F   +LF+ I   HARV  K R +E +
Sbjct: 398 IARRFVIAFE-GSFRLRCLFNALKLFASITITHARVRDKRRVREGI 442


>SB_43681| Best HMM Match : MAM (HMM E-Value=2.5e-20)
          Length = 1468

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
 Frame = -1

Query: 278  FVLKPNTNTTSGVTL---YILASFSRISVLLTVGFPGCKTSQT 159
            F+  PN   ++  TL    ++ S  R+ V+ +VG PGC  S T
Sbjct: 904  FISIPNITISNTFTLSWWMLVQSVQRVYVMTSVGNPGCGASPT 946


>SB_24027| Best HMM Match : FAD_binding_7 (HMM E-Value=0)
          Length = 1074

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = -3

Query: 228 FGELLTDLGLADGWFSWM*NIANHLLA 148
           FGEL+ D G +   F+W+ N++N +LA
Sbjct: 76  FGELMLDAGWSRNAFNWL-NMSNSMLA 101


>SB_22216| Best HMM Match : PGAMP (HMM E-Value=4)
          Length = 132

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
 Frame = -2

Query: 412 YAVCAWASSSRTGRGGLTCAWARTSWPDRVCRRSKRIQL-TCHLRS 278
           Y  CA   S      G+ C +A  + PD   RRS R    T H RS
Sbjct: 62  YGTCAMPDSGIPPPPGVLCRYAPCAMPDPKMRRSNRSSSGTTHNRS 107


>SB_16395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 12/30 (40%), Positives = 20/30 (66%)
 Frame = +1

Query: 349 PKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           P+  L  H L ++ R  R+QR ER++R+K+
Sbjct: 21  PQQILFTHRLEQRYRVERRQRLERRHRVKR 50


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,997,093
Number of Sequences: 59808
Number of extensions: 412997
Number of successful extensions: 1101
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1024
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1096
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1669334250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -