SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42943| Best HMM Match : WD40 (HMM E-Value=0)                       179   1e-45
SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21)                 179   1e-45
SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   2e-08
SB_36541| Best HMM Match : WD40 (HMM E-Value=0)                        53   2e-07
SB_23517| Best HMM Match : WD40 (HMM E-Value=0)                        52   3e-07
SB_40185| Best HMM Match : WD40 (HMM E-Value=0)                        51   9e-07
SB_17121| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_39225| Best HMM Match : NIF (HMM E-Value=0)                         48   5e-06
SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   6e-06
SB_9416| Best HMM Match : WD40 (HMM E-Value=0)                         48   8e-06
SB_50716| Best HMM Match : WD40 (HMM E-Value=0)                        47   1e-05
SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.)               47   1e-05
SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34)                  46   2e-05
SB_46083| Best HMM Match : WD40 (HMM E-Value=3.5e-18)                  46   3e-05
SB_46201| Best HMM Match : WD40 (HMM E-Value=0)                        45   6e-05
SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   6e-05
SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41)              44   1e-04
SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24)                    44   1e-04
SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30)                  43   2e-04
SB_6741| Best HMM Match : WD40 (HMM E-Value=0)                         43   2e-04
SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42)              43   2e-04
SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.)               43   2e-04
SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_8639| Best HMM Match : WD40 (HMM E-Value=1.9e-22)                   42   3e-04
SB_32323| Best HMM Match : WD40 (HMM E-Value=0)                        42   4e-04
SB_29857| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28)                   42   4e-04
SB_5842| Best HMM Match : WD40 (HMM E-Value=6.7e-21)                   41   7e-04
SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18)                   41   7e-04
SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_25576| Best HMM Match : WD40 (HMM E-Value=1.6e-30)                  40   0.001
SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40)                  40   0.001
SB_39595| Best HMM Match : WD40 (HMM E-Value=1.10001e-40)              40   0.002
SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24)                   40   0.002
SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_57108| Best HMM Match : WD40 (HMM E-Value=7.00649e-45)              40   0.002
SB_42895| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_37154| Best HMM Match : WD40 (HMM E-Value=7.00649e-45)              40   0.002
SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0)                    40   0.002
SB_34456| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_54574| Best HMM Match : WD40 (HMM E-Value=0)                        39   0.004
SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42)               39   0.004
SB_22898| Best HMM Match : WD40 (HMM E-Value=5.9e-26)                  38   0.007
SB_20870| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.009
SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32)                  37   0.012
SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.012
SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.012
SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0)               37   0.012
SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.012
SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18)                    37   0.015
SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.020
SB_46758| Best HMM Match : WD40 (HMM E-Value=5.8e-13)                  36   0.027
SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.027
SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10)                  36   0.036
SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.036
SB_23694| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.036
SB_18573| Best HMM Match : WD40 (HMM E-Value=1.5e-06)                  36   0.036
SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.047
SB_46905| Best HMM Match : WD40 (HMM E-Value=8.9e-12)                  35   0.062
SB_8327| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.062
SB_14705| Best HMM Match : WD40 (HMM E-Value=3.6e-20)                  34   0.082
SB_1661| Best HMM Match : WD40 (HMM E-Value=5e-13)                     34   0.082
SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23)                  34   0.11 
SB_5728| Best HMM Match : Band_41 (HMM E-Value=1e-26)                  34   0.11 
SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35)                   34   0.11 
SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30)                  33   0.14 
SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.14 
SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36)                  33   0.14 
SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30)                  33   0.14 
SB_7988| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.14 
SB_17662| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_10188| Best HMM Match : WD40 (HMM E-Value=0.046)                    33   0.19 
SB_51892| Best HMM Match : WD40 (HMM E-Value=8.7e-14)                  33   0.19 
SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.25 
SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.25 
SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.25 
SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.33 
SB_5414| Best HMM Match : WD40 (HMM E-Value=6.6e-15)                   32   0.33 
SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.44 
SB_36772| Best HMM Match : WD40 (HMM E-Value=3.8e-05)                  32   0.44 
SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.44 
SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13)                  32   0.44 
SB_39216| Best HMM Match : WD40 (HMM E-Value=1.1e-14)                  31   0.58 
SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_43688| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11)                  30   1.3  
SB_20702| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22)                  30   1.8  
SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   1.8  
SB_40171| Best HMM Match : WD40 (HMM E-Value=0.00071)                  30   1.8  
SB_7214| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.3  
SB_44622| Best HMM Match : dsrm (HMM E-Value=3.1e-16)                  29   3.1  
SB_14873| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_13993| Best HMM Match : WD40 (HMM E-Value=2.6e-10)                  29   3.1  
SB_13850| Best HMM Match : WD40 (HMM E-Value=3.1e-06)                  29   3.1  
SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21)                  29   4.1  
SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.)                29   4.1  
SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18)                  29   4.1  
SB_9603| Best HMM Match : Extensin_2 (HMM E-Value=0.0058)              29   4.1  
SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22)                  28   5.4  
SB_47704| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_47471| Best HMM Match : WD40 (HMM E-Value=0.014)                    28   5.4  
SB_34704| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_46184| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.4  
SB_45184| Best HMM Match : C2 (HMM E-Value=1.1e-22)                    28   7.1  
SB_35960| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_54936| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_42985| Best HMM Match : MRJP (HMM E-Value=3.9)                      28   7.1  
SB_41604| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24)                27   9.4  
SB_57522| Best HMM Match : F5_F8_type_C (HMM E-Value=0.004)            27   9.4  
SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014)                   27   9.4  
SB_19699| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.4  
SB_7596| Best HMM Match : WD40 (HMM E-Value=7.1e-15)                   27   9.4  
SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.4  
SB_48230| Best HMM Match : DUF152 (HMM E-Value=1.5)                    27   9.4  
SB_27500| Best HMM Match : WD40 (HMM E-Value=3.5e-05)                  27   9.4  
SB_1087| Best HMM Match : HEAT (HMM E-Value=2.7)                       27   9.4  

>SB_42943| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 273

 Score =  179 bits (436), Expect = 1e-45
 Identities = 81/106 (76%), Positives = 90/106 (84%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E L LRGTL+GHNGWVTQIATNP  PD ILSSSRDK LIVW+LTRD+ NYG  +K L 
Sbjct: 38  MAEQLSLRGTLKGHNGWVTQIATNPSNPDTILSSSRDKKLIVWELTRDDANYGFAKKSLT 97

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GH+HF+SDVV+SSDG +ALSGSWDKTLRLWDL AG TTRRF  HTK
Sbjct: 98  GHNHFVSDVVMSSDGQFALSGSWDKTLRLWDLNAGVTTRRFVGHTK 143



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 1/97 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GHN +V+ +  +       LS S DKTL +W L     N G+  +R  GH+  +  V
Sbjct: 95  SLTGHNHFVSDVVMSSD-GQFALSGSWDKTLRLWDL-----NAGVTTRRFVGHTKDVLSV 148

Query: 248 VLSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHT 355
             S+D    +SG+ D  ++LW+ L   K T + E H+
Sbjct: 149 AFSADNRQIVSGARDHHIKLWNTLGVCKYTIQEETHS 185



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 12/78 (15%)
 Frame = +2

Query: 131 ILSSSRDKTLIVW------KLTRDENNYGIPQKRLYGHSH------FISDVVLSSDGNYA 274
           I+S +RD  + +W      K T  E  + +   +L           +++ V +S DG+  
Sbjct: 157 IVSGARDHHIKLWNTLGVCKYTIQEETHSVEPDQLPSEDQPHWPPGYLNCVTVSPDGSLC 216

Query: 275 LSGSWDKTLRLWDLAAGK 328
            SG  D    LWDL  GK
Sbjct: 217 ASGGKDGQAMLWDLNDGK 234


>SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21)
          Length = 123

 Score =  179 bits (436), Expect = 1e-45
 Identities = 81/106 (76%), Positives = 90/106 (84%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E L LRGTL+GHNGWVTQIATNP  PD ILSSSRDK LIVW+LTRD+ NYG  +K L 
Sbjct: 1   MAEQLSLRGTLKGHNGWVTQIATNPSNPDTILSSSRDKKLIVWELTRDDANYGFAKKSLT 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GH+HF+SDVV+SSDG +ALSGSWDKTLRLWDL AG TTRRF  HTK
Sbjct: 61  GHNHFVSDVVMSSDGQFALSGSWDKTLRLWDLNAGVTTRRFVGHTK 106


>SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1649

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 35/103 (33%), Positives = 51/103 (49%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET     +L GH+G V  IA       ++ S+S+D+TL +W L    +        L GH
Sbjct: 820  ETCAFVNSLDGHDGHVRGIAITSDGRRLV-SASQDRTLRIWNLETFAH-----VSTLRGH 873

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S  +  V  S D  +A+SGS D  +++WDL + K  R    HT
Sbjct: 874  SETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHT 916



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 28/102 (27%), Positives = 51/102 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET K    L  H   V  +A +P + D ++S + D T+ +W    D +   +    L GH
Sbjct: 736  ETGKELNKLLDHTKLVYTLALSP-HADFLVSGAFDHTVKIW----DMDTLSLVHT-LKGH 789

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +++S V+++ D    +S S+DKT+++WD+         + H
Sbjct: 790  KNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGH 831



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 30/95 (31%), Positives = 45/95 (47%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            E+ K   +L GH   +  +A  P     ++SS  D  + VW L   E         L+GH
Sbjct: 904  ESAKEVRSLVGHTSDIFAVAVTPD-GSKVISSGDDTQVKVWSLESGEE-----LASLHGH 957

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
            S  +  V +S DG   +SGS D T ++W +A+  T
Sbjct: 958  SESVRIVTVSPDGLTIVSGSEDATFKIWRIASMNT 992



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 27/96 (28%), Positives = 46/96 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GH+  V  +  +P     I+S S D T  +W++     N   P   + GH   I+ +
Sbjct: 953  SLHGHSESVRIVTVSPDGLT-IVSGSEDATFKIWRIA--SMNTISP---VLGHKRTINGI 1006

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS +G++ ++GS D  +++WD         F  HT
Sbjct: 1007 ALSKNGDFCVTGSDDSLVKVWDGKIYSELMTFSGHT 1042



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 27/104 (25%), Positives = 47/104 (45%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET     TLRGH+  V  +  +P      +S S D  + +W L   +       + L GH
Sbjct: 862  ETFAHVSTLRGHSETVYCVCCSPD-DKFAISGSEDTMVKIWDLESAKE-----VRSLVGH 915

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +  I  V ++ DG+  +S   D  +++W L +G+       H++
Sbjct: 916  TSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSE 959



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 2/99 (2%)
 Frame = +2

Query: 53   LKLRGTLRGHNGWVTQIATNPKYP--DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +K R  +R  NG   +      +P  D ++S+    TL  W L           K +Y H
Sbjct: 1524 IKSREVIRSANGHWGRYNVVSFFPQGDQVVSNGHHFTLKQWDLGSGRI------KHIYPH 1577

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S+ I+ + +   G Y ++GS DK LRLW+    +   RF
Sbjct: 1578 SNEITTLCVLPCGRYLVTGSRDKILRLWEAGNPECVSRF 1616



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 15/47 (31%), Positives = 25/47 (53%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           G S  I  + ++ D    ++G  D ++R+WD   GK   +  DHTK+
Sbjct: 704 GRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKL 750



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 24/92 (26%), Positives = 38/92 (41%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH   +  IA + K  D  ++ S D  + VW    D   Y        GH+  +  + L 
Sbjct: 998  GHKRTINGIALS-KNGDFCVTGSDDSLVKVW----DGKIYS-ELMTFSGHTDCVQAIALC 1051

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             D + A SG  D  + +W+LA        ++H
Sbjct: 1052 PDSSLAASGGNDCVINIWNLAPFSRKLSLKEH 1083


>SB_36541| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 1070

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 31/86 (36%), Positives = 52/86 (60%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L+ + TL+GH   +  IA + +   +I+S+S+D  L VW   R E+   +  + L GHS 
Sbjct: 452 LECQATLKGHTSLIWAIAVS-RDDSVIVSASKDDLLKVW---RTES--WVCTQTLIGHSS 505

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLW 310
           +IS V +++DG   +SGS DK +++W
Sbjct: 506 WISCVAMTTDGKTIISGSNDKNVKMW 531



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 31/89 (34%), Positives = 45/89 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+    RGH G +  I    K  D ++S S D T+  W L   E+   + Q    GHS  
Sbjct: 329 KMMLEFRGHEGAINAILVTAK--DWVISGSDDSTVRAWDLENGES-CAVFQ----GHSKP 381

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           +  + + +DG   +SGS DK LR+WDL +
Sbjct: 382 VLCLQIINDGQAIVSGSEDKVLRVWDLVS 410



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 30/95 (31%), Positives = 55/95 (57%), Gaps = 2/95 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+  VT +        ++ S S+D T+ +W LT+ E      ++ + GH++ +  + 
Sbjct: 670 LRGHDKGVTALLIMNDCRHLV-SGSKDSTIRLWDLTKGEC-----KQVMQGHTNEVLCLS 723

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK--TTRRFED 349
           ++S+    +SGS D T R+W++A GK  +T +F+D
Sbjct: 724 VTSNDKTIVSGSNDFTARVWNVATGKCVSTVKFQD 758



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 29/96 (30%), Positives = 50/96 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H+G VT  A   +    ++S S D T+ +  + RD +        L GH   ++ +
Sbjct: 627 TIARHDGAVT-CAQVTQDGTQVVSGSADGTVRLHSVLRDRDGMV-----LRGHDKGVTAL 680

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++ +D  + +SGS D T+RLWDL  G+  +  + HT
Sbjct: 681 LIMNDCRHLVSGSKDSTIRLWDLTKGECKQVMQGHT 716



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 27/96 (28%), Positives = 45/96 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+GH G +  +A        I+S ++D  + VW L R E      Q  L GH+  I  +
Sbjct: 415 SLKGHGGLIKCLAAMHD-GKRIVSGAKDNNIKVWDLVRLEC-----QATLKGHTSLIWAI 468

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S D +  +S S D  L++W   +   T+    H+
Sbjct: 469 AVSRDDSVIVSASKDDLLKVWRTESWVCTQTLIGHS 504



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 23/77 (29%), Positives = 34/77 (44%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I+S S DK L VW L   +         L GH   I  +    DG   +SG+ D  +++W
Sbjct: 394 IVSGSEDKVLRVWDLVSRDC------VSLKGHGGLIKCLAAMHDGKRIVSGAKDNNIKVW 447

Query: 311 DLAAGKTTRRFEDHTKV 361
           DL   +     + HT +
Sbjct: 448 DLVRLECQATLKGHTSL 464



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 16/46 (34%), Positives = 30/46 (65%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GH   I+ +++++  ++ +SGS D T+R WDL  G++   F+ H+K
Sbjct: 336 GHEGAINAILVTAK-DWVISGSDDSTVRAWDLENGESCAVFQGHSK 380



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 20/77 (25%), Positives = 38/77 (49%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I++S  D  + +W     EN+  I   ++ G     S +VL++D  + ++ + D +   W
Sbjct: 229 IVTSGGDSLINIWNT---ENHDCIHTLKIGGKGQ--SHLVLTNDDRFVVAAA-DSSFGAW 282

Query: 311 DLAAGKTTRRFEDHTKV 361
           D+  G+    FE H K+
Sbjct: 283 DIDTGEKVVSFESHVKI 299



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           K L  H+H +  + L    N  +S S D T+++WD+A       F+  ++V
Sbjct: 795 KDLNAHTHAVMRIELLRAHNMLVSSSRDGTVKVWDVANAHVIDSFDFQSQV 845



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 22/89 (24%), Positives = 39/89 (43%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           VT++AT+PK    +++ S D  + +W     E         +  H   ++   ++ DG  
Sbjct: 597 VTRVATSPK----VVTGSSDGEMKLWDCVTGEC------VTIARHDGAVTCAQVTQDGTQ 646

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +SGS D T+RL  +   +       H K
Sbjct: 647 VVSGSADGTVRLHSVLRDRDGMVLRGHDK 675


>SB_23517| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 860

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 1/101 (0%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSH 232
           K  G L+GH G V  +  N    +  L+   DK L +W      N +   + + Y GH +
Sbjct: 562 KQTGLLQGHQGAVRAVRFNSD-GNYCLTCGSDKILALW------NPHKATRLKTYSGHGY 614

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            + D V + D +   S S D+T+ LWD++ G+  RR+  HT
Sbjct: 615 EVLDAVAAGDSSRIASCSADRTVVLWDVSTGQVIRRYRGHT 655



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH G+    A        I S S D+T+++W ++      G   +R  GH+  ++ V
Sbjct: 608 TYSGH-GYEVLDAVAAGDSSRIASCSADRTVVLWDVST-----GQVIRRYRGHTSRVNCV 661

Query: 248 VLSS-DGNYALSGSWDKTLRLWD 313
             +  D    +SGS+D T+R WD
Sbjct: 662 KFNQPDSTVIISGSYDSTIRCWD 684


>SB_40185| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 503

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 29/93 (31%), Positives = 44/93 (47%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGHN  V  +   P+      S+S D+T  +W     +     P +   GH   ++ V  
Sbjct: 122 RGHNYPVWDVQFCPR-GHYFASTSHDRTARLWSTDHQQ-----PLRIFAGHVSDVNKVAF 175

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS D+T+RLWD+  G + R F  H
Sbjct: 176 HPNCNYIATGSSDRTVRLWDIQTGSSVRLFTGH 208



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 1/109 (0%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           PF +M+ +   R  L GH+G V  ++ +      +LS S DKT+ +W L      +    
Sbjct: 67  PFPEMTASESRR--LVGHSGPVFAVSIDHDNK-FLLSCSEDKTIRLWSL------FTFTT 117

Query: 209 KRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              Y GH++ + DV     G+Y  S S D+T RLW     +  R F  H
Sbjct: 118 LVAYRGHNYPVWDVQFCPRGHYFASTSHDRTARLWSTDHQQPLRIFAGH 166



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GH   +  +  S +G + +S   D  L +WDLA G      + HT
Sbjct: 265 LSGHKAAVQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAELKGHT 311



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 24/81 (29%), Positives = 34/81 (41%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +A +     +I SS  D  L+VW L       G     L GH+  +  + 
Sbjct: 265 LSGHKAAVQSLAFSRNGRHLI-SSGVDTRLLVWDLAE-----GTLVAELKGHTDTVYSLC 318

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S DG    S   D  ++LW+
Sbjct: 319 FSRDGTILASAGLDNCIKLWN 339


>SB_17121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 596

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 2/104 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYP--DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           L+    +R ++G ++ +     +P  D++L+  RD T  VW +      +      L GH
Sbjct: 348 LEYNKVIRHYHGHLSAVYDADIHPTIDVLLTCGRDATTRVWDIRTKACIH-----TLTGH 402

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++ +S V   +     ++GS D T+RLWDLAAGK+     +H K
Sbjct: 403 TNTVSSVRAQAVDPQVITGSHDCTIRLWDLAAGKSAVTLTNHKK 446



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = +2

Query: 167 WKLTRD-ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           WKL R  +   G  +  L GH   +  +V+S    Y  S   DK ++ WDL   K  R +
Sbjct: 298 WKLMRIWDLGSGKLKLSLTGHISTVRGLVVSPRHPYLFSAGEDKLVKCWDLEYNKVIRHY 357

Query: 344 EDH 352
             H
Sbjct: 358 HGH 360


>SB_39225| Best HMM Match : NIF (HMM E-Value=0)
          Length = 1772

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 29/90 (32%), Positives = 45/90 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   L  H   +T    +P +  +  +S  + T IV   T D ++  +    L GH + 
Sbjct: 156 KLIKKLFNHRNTITCCRFSPLHNRICSTSMDNTTKIVDVRTFDTSSNNVTLS-LGGHINI 214

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +S    SSD +   +GSWDK ++LWD+A G
Sbjct: 215 VSTCCFSSDEHMLATGSWDKNIQLWDVATG 244



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I+++S DKT+ +W     + + G   K   GH+  I+    ++     +SG WDKTL +W
Sbjct: 54  IVTASHDKTIRLW-----DASSGNQLKVYTGHTSIITSCHPNTTSRKLISGGWDKTLIMW 108

Query: 311 DLAAG 325
           D+  G
Sbjct: 109 DVETG 113



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   +T    N     +I S   DKTLI+W +      +   Q+ +    HF      S
Sbjct: 79  GHTSIITSCHPNTTSRKLI-SGGWDKTLIMWDVETGCALWQAVQEGIVTTCHF------S 131

Query: 257 SDGNYALSGS-WDKTLRLWDLAAGKTTRRFEDH 352
           SDG Y +SG+  D  + +WD   GK  ++  +H
Sbjct: 132 SDGKYVVSGNDLDYAVCVWDARDGKLIKKLFNH 164



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           K + GH+  ++      D    ++ S DKT+RLWD ++G   + +  HT +
Sbjct: 33  KVMRGHTDSVNSCRFCFDDAKIVTASHDKTIRLWDASSGNQLKVYTGHTSI 83


>SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1803

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 33/103 (32%), Positives = 51/103 (49%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S+T  L   L GH G VT +  +P    +I SSS DKT+ +W  + DE       + L G
Sbjct: 1210 SKTGALLAQLDGHAGAVTCVRVSPD-GGVIASSSADKTIRLWNPS-DEF-----LRSLEG 1262

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H   ++ +  S +G   +S + DK L++WD+ +G        H
Sbjct: 1263 HEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGH 1305



 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 21/48 (43%), Positives = 31/48 (64%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            L GHS ++ DV  SSDG    SGS D+T+R+WD AA +  ++   H++
Sbjct: 1454 LGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDCAAAEKLKKARFHSE 1501



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 29/96 (30%), Positives = 44/96 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+ WV  +A +     ++ S SRD+T+ VW     E       K+   HS     V 
Sbjct: 1454 LGGHSDWVMDVAFSSDGA-LLTSGSRDRTVRVWDCAAAEK-----LKKARFHSERCWSVA 1507

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG +  S S D  + +W++A  +    +E H K
Sbjct: 1508 YSDDGMWLASASDDFKVCVWNMATQQHVLVYEGHEK 1543



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 26/74 (35%), Positives = 38/74 (51%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            I S S D T+ VW     ++  G    +L GH+  ++ V +S DG    S S DKT+RLW
Sbjct: 1196 IFSGSEDCTIRVW-----DSKTGALLAQLDGHAGAVTCVRVSPDGGVIASSSADKTIRLW 1250

Query: 311  DLAAGKTTRRFEDH 352
            +  + +  R  E H
Sbjct: 1251 N-PSDEFLRSLEGH 1263



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 34/116 (29%), Positives = 49/116 (42%), Gaps = 17/116 (14%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-----TR------DENN 193
            E+  L  TL GH+G+    A NP    M+ +   +  L++W L     TR      DE  
Sbjct: 1294 ESGNLLDTLTGHDGYPVCCAWNPVDNTMVATCGDNLELLIWDLETKSSTRLKSHGIDEAM 1353

Query: 194  YGIP-QKRLYGHSHFISD-----VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
               P +K+L GH     D     V  S DG    S   D  + +WD++ G+    F
Sbjct: 1354 VNFPDKKKLSGHERLRYDSLVWSVDFSPDGMLLASTGADSNVIIWDISTGERRYTF 1409



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 17/49 (34%), Positives = 22/49 (44%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            Q  L GHS  +     S D     SGS D T+R+WD   G    + + H
Sbjct: 1174 QMELSGHSKGVLTTCFSIDDRKIFSGSEDCTIRVWDSKTGALLAQLDGH 1222



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            I + SRD+ + +W +       G  Q   + GH   I  V  S D +   S + D+T+R+
Sbjct: 1690 IATCSRDQKVRLWAVE------GYAQVAAMEGHESEIRVVSFSPDDSLLASAALDQTIRV 1743

Query: 308  WDLAA 322
            WDL++
Sbjct: 1744 WDLSS 1748



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 26/102 (25%), Positives = 43/102 (42%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET  +   L GH+ +      +P   + I+SSS D T  VW+   D + +    +    H
Sbjct: 1622 ETECVLTALGGHDMFCQYTEFSPS-GEFIISSSIDNTAQVWRF--DTHRHVTTLQ----H 1674

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + +  V S D  +  + S D+ +RLW +         E H
Sbjct: 1675 PDWATCAVFSHDERHIATCSRDQKVRLWAVEGYAQVAAMEGH 1716


>SB_9416| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 700

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 31/95 (32%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L G    +  +A NP    +++S S +K L VW     E        +L GH   +  V
Sbjct: 164 SLSGQKDSIYSLAMNPA-GTVLISGSTEKILRVWDPRSCEK-----VMKLKGHMDNVKAV 217

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V+ SDG   LSGS D T+RLW L   +    +  H
Sbjct: 218 VIDSDGQQCLSGSSDGTVRLWSLGQQRCVAVYRIH 252



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S+ RD  +  W + R+E         L  H+ +++D+VL  +G   LS S D T+++W
Sbjct: 45  LYSAGRDSIIRCWNV-RNERIKDPYMVSLEHHTDWVNDIVLCRNGKTILSASSDTTVKVW 103

Query: 311 DLAAG---KTTRRFEDHTK 358
           D   G    T R  +D+ +
Sbjct: 104 DATRGFCMSTLRTHKDYVQ 122



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 4/99 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYGHSHF 235
           TLR H  +V  +A      + + S   DK + +W +         N  +    L G    
Sbjct: 113 TLRTHKDYVQALAY-ASCKEHVASGGLDKQIFLWDVNTLTALTATNNTVTTSSLSGQKDS 171

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I  + ++  G   +SGS +K LR+WD  + +   + + H
Sbjct: 172 IYSLAMNPAGTVLISGSTEKILRVWDPRSCEKVMKLKGH 210


>SB_50716| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 494

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 303 ISLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHRR 354

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 355 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 395


>SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 801

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/77 (33%), Positives = 41/77 (53%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ S  +D  + VWKL   +      ++    HS  ++ V  S D +  LSGS+D T+R
Sbjct: 277 EMLASGGQDGKIKVWKLQTGQ----CLRRFERAHSKGVTCVTFSRDASQLLSGSFDMTIR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  L +GKT + F  HT
Sbjct: 333 MHGLKSGKTLKEFRGHT 349



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 27/96 (28%), Positives = 50/96 (52%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR   R H+  VT + T  +    +LS S D T+ +  L       G   K   GH+ F+
Sbjct: 299 LRRFERAHSKGVTCV-TFSRDASQLLSGSFDMTIRMHGLKS-----GKTLKEFRGHTSFV 352

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +DV+ ++D ++ +S S D T+++W++ + +    F+
Sbjct: 353 NDVIFTADAHHIISASSDGTIKIWNIKSTECQHTFK 388



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 4/112 (3%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP--- 205
           S+MS+T+K  GT + H     + A        +++ S D  + VW  T  +    +    
Sbjct: 203 SQMSKTIKF-GT-KSH----PECAAFSPDGQYLVTGSVDGFIEVWNFTTGKIRKDLKYQA 256

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE-DHTK 358
           Q+        +  +  S D     SG  D  +++W L  G+  RRFE  H+K
Sbjct: 257 QENFMMMDETVLCLTFSRDSEMLASGGQDGKIKVWKLQTGQCLRRFERAHSK 308


>SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34)
          Length = 292

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 29/96 (30%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V  +A N    DM+ S SRD+ +    L RD  +    ++RL GH   +  +
Sbjct: 100 TMDGHSARVGALAWNG---DMLSSGSRDRLI----LQRDTRSPTQLERRLVGHRQEVCGL 152

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S D  +  SG  D  L +W+L+     +++ +HT
Sbjct: 153 KWSPDHQHLASGGNDNKLLVWNLSGSTPIQQYSEHT 188



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +L GHS  +  + +S DG   ++G+ D+TLR W++
Sbjct: 237 KLTGHSFRVLYLAVSPDGEAIVTGAGDETLRFWNV 271


>SB_46083| Best HMM Match : WD40 (HMM E-Value=3.5e-18)
          Length = 246

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 1/95 (1%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG-HSHFI 238
           R  LRGH G V  I  + K  ++++S   D+ ++VW + R   N  +   ++ G H   I
Sbjct: 68  RKDLRGHFGCVNAIEFSNKGGELVVSGGDDRRVLVWDIERSLTNTKLSPAQMKGQHRSNI 127

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
              V S+D N   S   D      DL  G+T   F
Sbjct: 128 FCTVFSNDNNLIYSAGNDDQAMRHDLKTGETVGVF 162


>SB_46201| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 292

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 35/117 (29%), Positives = 53/117 (45%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +S  S   K   K  +   L  +L  H G +  +  +      I++ S DKT  +W  TR
Sbjct: 5   SSKGSGCTKKGDKKKDKTFLIKSLEHHEGGINAMCISSD-GKTIVTGSEDKTGRLWD-TR 62

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            E+  G     L GH  +I+ V  S    YA + + DKT+R W L  G+  + F+ H
Sbjct: 63  TEDTIG----ELQGHVGYINGVCASD--KYAFTCASDKTIRKWSLETGRCIKVFKGH 113



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 20/77 (25%), Positives = 33/77 (42%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D++++ S D T   W +  +E           GH   I  + +   G    +GS D T+R
Sbjct: 168 DILVTGSADNTAKAWGMNSNEC-----MNTFKGHEGAILCLAVDGKGRLLFTGSSDSTIR 222

Query: 305 LWDLAAGKTTRRFEDHT 355
            WDL      + F+ H+
Sbjct: 223 SWDLHTYSPLKSFKGHS 239


>SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 247

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/73 (34%), Positives = 38/73 (52%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L++S DK+L VW + R +  Y      L  H +++     S DG   +SGS DKT++LW
Sbjct: 43  LLTASDDKSLKVWTVHRQKFLYS-----LNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLW 97

Query: 311 DLAAGKTTRRFED 349
           D  +      F D
Sbjct: 98  DRTSKDCVHTFYD 110


>SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41)
          Length = 1487

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 30/107 (28%), Positives = 52/107 (48%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            A+G    F+ F    +T +L   L GH   V+ +A +P +P +++S + DKT+ +W +  
Sbjct: 1352 AAGSRDTFEIFVWSIQTGRLLEVLAGHEAPVSSLAFSPSHP-VLISGAWDKTVRLWNVFE 1410

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
             +    + ++ L   S  +S + +  DG      S D  L  WDL A
Sbjct: 1411 SK----VSRETLNLTSDVVS-IAVRPDGREVAISSLDGALTFWDLEA 1452



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +2

Query: 125  DMILSSSRDK-TLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            +++ + SRD   + VW +       G   + L GH   +S +  S      +SG+WDKT+
Sbjct: 1349 EVVAAGSRDTFEIFVWSIQT-----GRLLEVLAGHEAPVSSLAFSPSHPVLISGAWDKTV 1403

Query: 302  RLWDLAAGKTTR 337
            RLW++   K +R
Sbjct: 1404 RLWNVFESKVSR 1415



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 22/88 (25%), Positives = 43/88 (48%)
 Frame = +2

Query: 92   VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
            ++ +A NP    +    +    L+VW+   +  +Y + Q+   GH + ++ +  S DGNY
Sbjct: 1211 ISAVAVNPTGEWLAFGCTSLGQLLVWEWQSE--SYILKQQ---GHYYDMNVLAYSPDGNY 1265

Query: 272  ALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              +G  D  ++LW+   G     F +H+
Sbjct: 1266 IATGGDDGKVKLWNTMTGFCFVTFHEHS 1293


>SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 642

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 12/93 (12%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLT--------RDENNYGIP----QKRLYGHSH 232
           +++ +  + K  +++  S +D  + +WKLT         D+ N  +      K L GH  
Sbjct: 122 FLSNLTRHTKAVNVVRFSPKDSVVFIWKLTCSSEHQHILDDENDNLETWTVSKMLRGHIE 181

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
            + D+  S DG   LSGS D +  +WD   GKT
Sbjct: 182 DVYDLAWSPDGTQLLSGSVDNSAIIWDAIKGKT 214



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY------GIPQ 208
           ET  +   LRGH   V  +A +P     +LS S D + I+W   + +         G   
Sbjct: 168 ETWTVSKMLRGHIEDVYDLAWSPD-GTQLLSGSVDNSAIIWDAIKGKTEILNSPSEGTKL 226

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
             L  H H++  V     G Y ++ S D++ RL++
Sbjct: 227 TILKDHKHYVQGVCWDPLGQYVVTNSSDRSCRLYN 261


>SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24)
          Length = 515

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 20/38 (52%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           TL GH   V  +A NP+ PDM++S+S D TL VWK  R
Sbjct: 472 TLTGHQNVVNCVAFNPRDPDMLVSASDDHTLRVWKSRR 509


>SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 418

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 24/69 (34%), Positives = 32/69 (46%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D + S S D T  +W L  +   Y      L GH+  ++ +V     N  L+ S DKTL 
Sbjct: 258 DFLASCSMDNTSKIWDLNSERCRY-----TLRGHADSVNSIVFLPYSNTLLTSSADKTLS 312

Query: 305 LWDLAAGKT 331
           LWD   G T
Sbjct: 313 LWDARTGDT 321



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/74 (24%), Positives = 32/74 (43%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +SS D T+ +W  ++ E            H+H +      S G++  S S D T ++W
Sbjct: 218 LATSSGDGTVKIWDFSKAECVLTFAD-----HTHAVWGCTWHSKGDFLASCSMDNTSKIW 272

Query: 311 DLAAGKTTRRFEDH 352
           DL + +       H
Sbjct: 273 DLNSERCRYTLRGH 286



 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L GH   +  V+    G + LS   D T+R+W
Sbjct: 385 QLTGHEDAVQSVLFDRAGEFLLSSGSDGTVRIW 417


>SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30)
          Length = 1093

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 31/102 (30%), Positives = 45/102 (44%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K R  ++ H   V ++  NP Y +++ S S D ++ VW    D    GI  K    H   
Sbjct: 195 KSRLKIQAHTSGVNRLDWNPVYTNLLASCSMDNSVRVW----DTYLNGICVKSHTFHGGA 250

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + DV  S  G   LS  +DK+ RL D+  G     F  +  V
Sbjct: 251 VKDVKWSPGGMQLLSCGYDKSSRLIDIHTGCQVSLFHQNDYV 292


>SB_6741| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 714

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S S DKT  +W +   E    + Q  L GH++ ++   +S  G    + S D TL L
Sbjct: 26  VLASCSGDKTARLWDV---EKGTELAQSPLDGHNYHVNSCSVSPFGTLMATASTDSTLML 82

Query: 308 WDLAAGKTTRRFEDHT 355
           W+L  G+     E HT
Sbjct: 83  WNLETGECLAVLEGHT 98



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 26/89 (29%), Positives = 43/89 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GHN  V   + +P +  ++ ++S D TL++W L   E         L GH+  +    
Sbjct: 52  LDGHNYHVNSCSVSP-FGTLMATASTDSTLMLWNLETGEC-----LAVLEGHTGAVRVCR 105

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            S +  + +SGS D+T  +WD+   K  R
Sbjct: 106 FSPNSQFLISGSADETFIIWDVLLKKPVR 134



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 24/102 (23%), Positives = 45/102 (44%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +    L GH G V     +P     ++S S D+T I+W +   +     P + +   
Sbjct: 86  ETGECLAVLEGHTGAVRVCRFSPN-SQFLISGSADETFIIWDVLLKK-----PVRCVDKL 139

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    + DG + ++G+ +  L +W+   GK   + E H
Sbjct: 140 ESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGKFITQVEGH 181



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           H+  ++    S++     S S DKT RLWD+  G
Sbjct: 11  HTKDVTGCCFSANSRVLASCSGDKTARLWDVEKG 44


>SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42)
          Length = 198

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S S DKT  +W +   E    + Q  L GH++ ++   +S  G    + S D TL L
Sbjct: 26  VLASCSGDKTARLWDV---EKGTELAQSPLDGHNYHVNSCSVSPFGTLMATASTDSTLML 82

Query: 308 WDLAAGKTTRRFEDHT 355
           W+L  G+     E HT
Sbjct: 83  WNLETGECLAVLEGHT 98



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 26/89 (29%), Positives = 43/89 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GHN  V   + +P +  ++ ++S D TL++W L   E         L GH+  +    
Sbjct: 52  LDGHNYHVNSCSVSP-FGTLMATASTDSTLMLWNLETGEC-----LAVLEGHTGAVRVCR 105

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            S +  + +SGS D+T  +WD+   K  R
Sbjct: 106 FSPNSQFLISGSADETFIIWDVLLKKPVR 134



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 24/102 (23%), Positives = 45/102 (44%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +    L GH G V     +P     ++S S D+T I+W +   +     P + +   
Sbjct: 86  ETGECLAVLEGHTGAVRVCRFSPN-SQFLISGSADETFIIWDVLLKK-----PVRCVDKL 139

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    + DG + ++G+ +  L +W+   GK   + E H
Sbjct: 140 ESSVTACAFTPDGLHIITGTSEGKLAIWEAQKGKFITQVEGH 181



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           H+  ++    S++     S S DKT RLWD+  G
Sbjct: 11  HTKDVTGCCFSANSRVLASCSGDKTARLWDVEKG 44


>SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 468

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 31/123 (25%), Positives = 52/123 (42%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G + L  P ++          + GH G V  +A NP    MI + S D  +++W++  
Sbjct: 52  AGGGAFLVLPVTQKGRVEPDAPKVIGHKGAVLDLAWNPFDDHMIATGSEDARVMIWQIPE 111

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +N   P   L  H + +  V       N  LS S D  + +W+L   +  +  E+H
Sbjct: 112 HGLHSNISEPLVTLEYHQNRVGIVRWHPVASNILLSSSHDLKIVIWNLETAEAFQIIENH 171

Query: 353 TKV 361
           T +
Sbjct: 172 TAI 174



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 27/90 (30%), Positives = 44/90 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H   V  +  +P   +++LSSS D  +++W L   E  + I    +  H+  +  V
Sbjct: 124 TLEYHQNRVGIVRWHPVASNILLSSSHDLKIVIWNLETAEA-FQI----IENHTAIVYSV 178

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
             + DG+   + S DK LRL D  +GK  +
Sbjct: 179 SWNRDGSLFTTTSKDKKLRLVDPRSGKIVK 208


>SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 299

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 27/88 (30%), Positives = 45/88 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   T +GH   ++ +A   +    + S+S DKT+ +W L  DE  Y    + L+GH
Sbjct: 144 DTSKHIHTFKGHRDVISGLAFR-RGSHQLFSASHDKTVKIWNL--DEMAY---VETLFGH 197

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
              ++ +   S    A +G  D+TLR+W
Sbjct: 198 QDAVTGIDSLSRDRAATAGGRDRTLRIW 225



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           GH   I  + +++DG Y  SG  DK +R+WD    K    F+ H  V
Sbjct: 112 GHKEQILALAITTDGKYLASGGKDKLIRIWDPDTSKHIHTFKGHRDV 158



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 2/89 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           KL    +GH   +  +A  T+ KY   + S  +DK + +W     ++ +        GH 
Sbjct: 105 KLEAGSKGHKEQILALAITTDGKY---LASGGKDKLIRIWDPDTSKHIHTFK-----GHR 156

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             IS +      +   S S DKT+++W+L
Sbjct: 157 DVISGLAFRRGSHQLFSASHDKTVKIWNL 185


>SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 622

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 27/81 (33%), Positives = 38/81 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLR H+G V  +A +P     + S S D T+ +W   +      I    + GH+  +  V
Sbjct: 83  TLRQHSGDVLDLAWSPD-DSFLASGSVDNTVTIWNAQKFPEVIQI----IKGHTGLVKGV 137

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
                G Y  S S DKTLR+W
Sbjct: 138 TWDPVGKYLASQSDDKTLRVW 158



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT--RDENNYGIPQKRLYGHSHFISD 244
           ++GH G V  +  +P     + S S DKTL VW+ T  + E +   P     G +H +  
Sbjct: 127 IKGHTGLVKGVTWDP-VGKYLASQSDDKTLRVWRTTDWQQETSVTEPFLECSGTTHVLR- 184

Query: 245 VVLSSDGNYALS 280
           +  S DG+Y +S
Sbjct: 185 LSWSPDGHYVVS 196



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%)
 Frame = +2

Query: 170 KLTRDENNYGIPQK--RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           K   DE N  +P+   ++  H   ++ V  S +G Y  SG  D  + +W +A
Sbjct: 5   KNEEDEMNENVPKLLCQMDNHLACVNCVRWSGNGKYLASGGDDNLIMIWQMA 56



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           HS  + D+  S D ++  SGS D T+ +W+
Sbjct: 87  HSGDVLDLAWSPDDSFLASGSVDNTVTIWN 116


>SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 644

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +2

Query: 68  TLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH G  W +Q++ +     +I+S S D+TL VW     E  Y +    LYGH+  + 
Sbjct: 354 TLTGHTGGVWSSQLSGH-----IIVSGSTDRTLKVWNA---ETGYCM--HTLYGHTSTVR 403

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            + +  +    +SGS D TLR+WD   G
Sbjct: 404 CMDMHEE--VVVSGSRDGTLRVWDTTTG 429



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P K L GH   +    L   G+  +SGS D TL++W   +GK  R    HT
Sbjct: 310 PSKILKGHDDHVI-TCLQFSGSRVVSGSDDGTLKVWSALSGKCLRTLTGHT 359



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 30/104 (28%), Positives = 47/104 (45%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET     TL GH   V  +     + ++++S SRD TL VW  T      G     L G
Sbjct: 386 AETGYCMHTLYGHTSTVRCM---DMHEEVVVSGSRDGTLRVWDTTT-----GNCLHVLVG 437

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG+  +SG++D  +++WD    +     + HT
Sbjct: 438 HLAAVRCV--KYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHT 479



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 24/75 (32%), Positives = 35/75 (46%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S S D TL VW         G   + L GH+  +    LS  G+  +SGS D+TL++W
Sbjct: 332 VVSGSDDGTLKVWSALS-----GKCLRTLTGHTGGVWSSQLS--GHIIVSGSTDRTLKVW 384

Query: 311 DLAAGKTTRRFEDHT 355
           +   G        HT
Sbjct: 385 NAETGYCMHTLYGHT 399



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG Y +SGS D ++R+W    G+       H
Sbjct: 475 LQGHTNRVYS--LQFDGTYIVSGSLDTSIRVWHAETGQCLHTLVGH 518


>SB_8639| Best HMM Match : WD40 (HMM E-Value=1.9e-22)
          Length = 442

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 3/98 (3%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD--ENNYGIPQKRLYGHSHFISDVV 250
           GH G V  +A NP    MI + S D  +++W++      +N   P   L  H + +  V 
Sbjct: 13  GHKGAVLDLAWNPFDDHMIATGSEDARVMIWQIPEHGLHSNISEPLVTLEYHQNRVGIVR 72

Query: 251 LSS-DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
                 N  LS S D  + +W+L   +  +  E+HT +
Sbjct: 73  WHPVASNILLSSSHDLKIVIWNLETAEAFQIIENHTAI 110



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 27/95 (28%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H   V  +  +P   +++LSSS D  +++W L   E       + +  H+  +  V
Sbjct: 60  TLEYHQNRVGIVRWHPVASNILLSSSHDLKIVIWNLETAE-----AFQIIENHTAIVYSV 114

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + DG+   + S DK LRL D  +GK  +    H
Sbjct: 115 SWNRDGSLFTTTSKDKKLRLVDPRSGKIVKEVNGH 149


>SB_32323| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 611

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 26/84 (30%), Positives = 45/84 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + +YP  ILSSS D+T+ +W     ++   I    L GH+H++   
Sbjct: 88  TLLGHLDYIRTTFFHHEYP-WILSSSDDQTIRIWNW---QSRTCICV--LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPSEDMVVSASLDQTVRVWDIS 165


>SB_29857| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1264

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTR--DENNYGIPQKRLYGHSHFISDVVLSSDGNYAL-SGSWDKT 298
           + +S SRD+++ +W LT+  +E      ++ L GH  ++  +     G   L SGSWD +
Sbjct: 158 LCVSGSRDRSIGIWDLTKLTEEEPQKAFKQSLDGHKGWVWSLACDPMGESRLCSGSWDNS 217

Query: 299 LRLWDL 316
           +++WDL
Sbjct: 218 VKVWDL 223



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 22/83 (26%), Positives = 39/83 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH GWV  +A +P     + S S D ++ VW L       G   +      H  + +
Sbjct: 188 SLDGHKGWVWSLACDPMGESRLCSGSWDNSVKVWDLR------GSIVEMTSIREHRAAVL 241

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
            +    +  ++G +DK +R++DL
Sbjct: 242 CMEWKQDVLVTGCYDKHVRMFDL 264


>SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28)
          Length = 539

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           GH++ I+DV  S DG + +S S D T+R WDL A +
Sbjct: 451 GHANRITDVSFSPDGRWLISSSMDSTIRTWDLPAAR 486


>SB_5842| Best HMM Match : WD40 (HMM E-Value=6.7e-21)
          Length = 759

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           YGHS  + DV  ++DG   LS  +D+ ++LWD   G+   R+
Sbjct: 130 YGHSKAVRDVSFNNDGTQFLSAGYDRYVKLWDTETGECLGRY 171


>SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18)
          Length = 736

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G VT ++ +P +PD +++SS D +  VW +   E N  I   R  GH   +  V 
Sbjct: 18  LVGHCGRVTALSWSPHHPDRLVTSSYDGSAQVWDV---ETNQPIANYR--GHVGRVMSVC 72

Query: 251 LS-SDGNYALSGSWDKTLRLW 310
            S  D +   SG  D T+R W
Sbjct: 73  WSYLDPDVVFSGGEDGTVRPW 93



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT 178
           ET +     RGH G V  +  +   PD++ S   D T+  W+++
Sbjct: 53  ETNQPIANYRGHVGRVMSVCWSYLDPDVVFSGGEDGTVRPWRVS 96


>SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1308

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 29/97 (29%), Positives = 45/97 (46%)
 Frame = +2

Query: 65   GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            G L+GH+  +  +       D+I S S D T+ +W L        I      G S  +S 
Sbjct: 1141 GQLKGHSSHIMSVYAAKD--DIIASGSNDNTVRLWDLRSQRCIDAIAT----GDS-CVSS 1193

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V ++  G   +SG  D    L+D+ AG+T + F+ HT
Sbjct: 1194 VCVNPSGTLLVSGHEDGGCMLYDITAGRTLQFFKPHT 1230



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 4/98 (4%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV-- 247
            R H G +  +A +    D+I + S DK++ V     D      P+  L  HS  I D+  
Sbjct: 1051 RHHRGSIYCMAWSST-GDLIATGSNDKSIKVLHFDADNCTQVGPELELNIHSGTIRDLSF 1109

Query: 248  VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V  + G+  L   G+ +  +++ D   G T  + + H+
Sbjct: 1110 VSRASGSAVLVSGGAGNGNIQISDCTTGNTIGQLKGHS 1147


>SB_25576| Best HMM Match : WD40 (HMM E-Value=1.6e-30)
          Length = 326

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +2

Query: 113 PKYPDMIL-SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           P+ P+ ++ +SS D T+ VW     +   G  ++ L GH+  + D+     G +  S S 
Sbjct: 69  PRPPESVMVTSSEDATVKVW-----DYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSA 123

Query: 290 DKTLRLWD 313
           D T++LWD
Sbjct: 124 DMTIKLWD 131



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAG 325
           S G + +S S DK++++WD++AG
Sbjct: 204 SPGPFLVSASRDKSIKIWDVSAG 226


>SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40)
          Length = 400

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 12/100 (12%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR--------DENN----YGIPQKR 214
           LRGH   V  ++ +P    ++ +  RD  +++W + +        D++N     G    R
Sbjct: 182 LRGHATAVLSVSWSPLNQYLLATGGRDNKVLLWDVRKAVSCLTALDQHNGKEASGSCNTR 241

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
              H+  I+ +  +SDG   LS   D  LRLWD   GK T
Sbjct: 242 T-AHNGHINSICFTSDGLNILSYGTDNRLRLWDTFTGKNT 280


>SB_39595| Best HMM Match : WD40 (HMM E-Value=1.10001e-40)
          Length = 260

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 32/105 (30%), Positives = 44/105 (41%), Gaps = 5/105 (4%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   LRGH   V  +         ILS+SRD+T  VW +T D            GH +F
Sbjct: 4   KLSSVLRGHELDVRAVFPGVFPEGSILSASRDRTTRVW-VTEDGGRTYSEGHAFAGHKNF 62

Query: 236 ISDV-VLSSDGNY----ALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           IS V  ++   NY      +G  D  + +W L + +       HT
Sbjct: 63  ISSVCAMAPTENYPHGLIATGGHDNVILVWTLDSVEPIYSLTGHT 107



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 32/96 (33%), Positives = 42/96 (43%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +    K+   +LS S DKT  VW   +           L GH   +  V
Sbjct: 102 SLTGHTDTVCSLVAG-KF-GTLLSGSWDKTAKVWLGPKCVMT-------LEGHDAAVWAV 152

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L  D    L+GS DKT++LW   AG     F  HT
Sbjct: 153 LLMPDHGLMLTGSADKTIKLW--KAGSCQSTFTGHT 186


>SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24)
          Length = 208

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 25/86 (29%), Positives = 42/86 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   + Q+  +P    +I S++ DK++ +W     E    I   R  GH + +  + 
Sbjct: 55  MTGHQALINQVCFSPD-GRLIASAAFDKSVKLWN---GETGKFITSLR--GHVNCVYQIA 108

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
            S+D     SGS D TL++WD+   K
Sbjct: 109 WSADCRLICSGSADSTLKVWDMKTKK 134



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           P  R+ GH   I+ V  S DG    S ++DK+++LW+   GK       H
Sbjct: 51  PLVRMTGHQALINQVCFSPDGRLIASAAFDKSVKLWNGETGKFITSLRGH 100


>SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 945

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 29/94 (30%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V+ +  +    + ++S S D T+ VW +   E         L GH   +S   
Sbjct: 598 LYGHKGCVSCLRFDE---NTLVSGSHDSTIRVWDMRTWECVLV-----LQGHEGAVS--C 647

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L  D  + LSGS DKT++LW++ +G        H
Sbjct: 648 LEFDAPFVLSGSADKTIKLWNVESGDCLNTLRGH 681



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/48 (33%), Positives = 30/48 (62%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +RL GH   +  + L  D    ++GS D+T+R+WD+ +G++ R+ + H
Sbjct: 516 RRLQGHMDVV--LCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGH 561



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 5/99 (5%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH G V+ +  +  +   +LS S DKT+ +W +       G     L GH+  ++ V 
Sbjct: 638 LQGHEGAVSCLEFDAPF---VLSGSADKTIKLWNVES-----GDCLNTLRGHADAVTSVK 689

Query: 251 LSSD-----GNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ D     G   LSGS D  +  WDL +G      + H
Sbjct: 690 VTLDTVQVIGELILSGSADGMILFWDLDSGHCEAAIQAH 728



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 22/89 (24%), Positives = 42/89 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+K    L+GH   V  +  + +    +++ S D+T+ +W +       G   +++ GH 
Sbjct: 511 TIKRVRRLQGHMDVVLCLQFDRR---RVVTGSSDRTIRMWDVRS-----GRSIRKMKGHK 562

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             +    L  D    +SGSWD T+ +W +
Sbjct: 563 GGVR--CLQFDNERIISGSWDMTIMVWHI 589


>SB_57108| Best HMM Match : WD40 (HMM E-Value=7.00649e-45)
          Length = 243

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 14/88 (15%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--------------DVVLSSDGN 268
           I+S S DKT+ VW L+R++ +  +    L GHS  +               D  +  D  
Sbjct: 39  IVSGSSDKTIKVWDLSREDTSAVL---TLAGHSGTVRCLNLNGNRLVSGSVDRSIKVDDE 95

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +SGS+DKTL++WD+  G        H
Sbjct: 96  KVVSGSYDKTLKVWDIKTGNCKLTLRGH 123



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           L GH   ++ + L+ D    +SGS D  L+ WDLA GK
Sbjct: 206 LAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATGK 243



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           GH+  IS V    D    +SGS DKT+++WDL+   T+
Sbjct: 24  GHTQGISCVQF--DDTRIVSGSSDKTIKVWDLSREDTS 59



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S S DKTL VW +       G  +  L GH+  +  + +  D +  +SGS+D T++
Sbjct: 95  EKVVSGSYDKTLKVWDI-----KTGNCKLTLRGHNAAV--LCVQFDESKIVSGSYDNTIK 147

Query: 305 LWDL 316
           + ++
Sbjct: 148 VKEI 151


>SB_42895| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = +2

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           DV  S+DGN   + S DKT+ LWD   G   +R + HT
Sbjct: 2   DVHFSTDGNTMFTASTDKTVALWDYETGARMKRLKGHT 39



 Score = 35.5 bits (78), Expect = 0.036
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRL 307
           + ++S DKT+ +W     +   G   KRL GH+ F++    S  G  Y +SGS D T+++
Sbjct: 12  MFTASTDKTVALW-----DYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKV 66

Query: 308 WDLA 319
             +A
Sbjct: 67  TAVA 70


>SB_37154| Best HMM Match : WD40 (HMM E-Value=7.00649e-45)
          Length = 870

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 14/88 (15%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--------------DVVLSSDGN 268
           I+S S DKT+ VW L+R++ +  +    L GHS  +               D  +  D  
Sbjct: 666 IVSGSSDKTIKVWDLSREDTSAVL---TLAGHSGTVRCLNLNGNRLVSGSVDRSIKVDDE 722

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +SGS+DKTL++WD+  G        H
Sbjct: 723 KVVSGSYDKTLKVWDIKTGNCKLTLRGH 750



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           L GH   ++ + L+ D    +SGS D  L+ WDLA GK
Sbjct: 833 LAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATGK 870



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           GH+  IS V    D    +SGS DKT+++WDL+   T+
Sbjct: 651 GHTQGISCVQF--DDTRIVSGSSDKTIKVWDLSREDTS 686



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S S DKTL VW +       G  +  L GH+  +  + +  D +  +SGS+D T++
Sbjct: 722 EKVVSGSYDKTLKVWDI-----KTGNCKLTLRGHNAAV--LCVQFDESKIVSGSYDNTIK 774

Query: 305 LWDL 316
           + ++
Sbjct: 775 VKEI 778


>SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0)
          Length = 3369

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 24/87 (27%), Positives = 46/87 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   +T++  +   PD+++S + +  + VW L+  E       + L GH+  I+ V
Sbjct: 3201 TLHGHRDGITELKVDSNNPDIVISGASNGGVRVWDLSTGE-----CLQHLRGHTCAITTV 3255

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              +S   + +S S D ++ +W+ + GK
Sbjct: 3256 --ASTHAHLISVSIDNSMCVWERSTGK 3280



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 19/76 (25%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRL 307
            +++ S D+TL V++      ++ +    L+GH   I+++ + S+  +  +SG+ +  +R+
Sbjct: 3179 VVTGSHDRTLKVFR-----TDHCVRIFTLHGHRDGITELKVDSNNPDIVISGASNGGVRV 3233

Query: 308  WDLAAGKTTRRFEDHT 355
            WDL+ G+  +    HT
Sbjct: 3234 WDLSTGECLQHLRGHT 3249


>SB_34456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 454

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           TL GH   V   A NP+   D++ S + D +L +W    D  +  +    + GH   +  
Sbjct: 38  TLAGHTTGVWTCAFNPERTGDILCSGADDGSLKLW----DIRSNSVVMSLVGGHDDRVKS 93

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S +G Y  S S D  + LW+   G    +   H
Sbjct: 94  CAWSPNGEYVASSSADGRVTLWEPRLGTALSKIRAH 129



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++DG    S SWDK + + D+  GK       HT
Sbjct: 10  NNDGKLLASASWDKFVIISDVPTGKPVNTLAGHT 43


>SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 297

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/77 (25%), Positives = 37/77 (48%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ ++S D T+ +W+ T D   + +          ++ D   S D  Y ++ S D   RL
Sbjct: 212 LLATTSADTTVRIWQ-TAD---FSLKTTLSDTSQRWVWDCAFSEDSQYLVTASSDNLARL 267

Query: 308 WDLAAGKTTRRFEDHTK 358
           W++ AG+  R +  H K
Sbjct: 268 WNVEAGEVVREYSGHQK 284


>SB_54574| Best HMM Match : WD40 (HMM E-Value=0)
          Length = 1050

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 25/93 (26%), Positives = 42/93 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V   + +P     + S S D+T+ VW     ++  G+       H+  +     S
Sbjct: 592 GHTQEVFSCSFSPDDTKAV-SCSADRTVKVW-----DSKTGVCYHVYMAHTDIVRWCCFS 645

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    S S D T+R+W+ ++G+     +DHT
Sbjct: 646 PDGGKVASCSDDNTVRIWEASSGEDLCLLDDHT 678



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 19/67 (28%), Positives = 33/67 (49%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+T    G  +GH GW   +  + K    ++S S D+T+ +W + RD        +R++ 
Sbjct: 747 SKTFARLGVYKGHKGWAHSVGIS-KDSSKLVSGSEDETVKIWTIDRDAAKDAAKLRRVF- 804

Query: 224 HSHFISD 244
            +HF  D
Sbjct: 805 DAHFGED 811



 Score = 35.9 bits (79), Expect = 0.027
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I+S S D+T+ +W  +  E   G+      GH+  +     S D   A+S S D+T+++W
Sbjct: 567 IISCSADQTVKIWDASSGE---GV--LCFVGHTQEVFSCSFSPDDTKAVSCSADRTVKVW 621

Query: 311 DLAAGKTTRRFEDHTKV 361
           D   G     +  HT +
Sbjct: 622 DSKTGVCYHVYMAHTDI 638



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 19/76 (25%), Positives = 37/76 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S   D  + VW     ++  G     + GH   ++    S D +  +S S D+T+++W
Sbjct: 525 VVSCGTDNHVKVW-----DSQSGRQLLSISGHGDVVNCCAFSHDDSRIISCSADQTVKIW 579

Query: 311 DLAAGKTTRRFEDHTK 358
           D ++G+    F  HT+
Sbjct: 580 DASSGEGVLCFVGHTQ 595



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLW----DLA--AGKTTRRFEDH 352
           GH  +   V +S D +  +SGS D+T+++W    D A  A K  R F+ H
Sbjct: 758 GHKGWAHSVGISKDSSKLVSGSEDETVKIWTIDRDAAKDAAKLRRVFDAH 807


>SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42)
          Length = 383

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 2/75 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNY--GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + +SS D T+  +++      +  G   + L GH   ++ V  S D  Y  SGS DK++R
Sbjct: 154 LATSSLDGTICHYRIKPGAGEFVPGQETRTLRGHQGAVNVVAFSLDNRYIFSGSDDKSIR 213

Query: 305 LWDLAAGKTTRRFED 349
           +W   + K      D
Sbjct: 214 IWSRESSKCENTLTD 228



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 19/58 (32%), Positives = 26/58 (44%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*G 388
           L GH   I +V +  DG    + S D T+ LW++  G+  R    H K   N  F  G
Sbjct: 47  LEGHKKAILNVEVGPDGKTLATCSADCTVGLWNITTGELLRTLVGHEKPVTNCAFMWG 104


>SB_22898| Best HMM Match : WD40 (HMM E-Value=5.9e-26)
          Length = 490

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 22/93 (23%), Positives = 35/93 (37%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T   H G V  +  +P    + +S   D    VWKL   E  +        GH   ++  
Sbjct: 74  TFEKHTGSVFSVGVDPVNSLLAVSGGEDDKAYVWKLANGEVMF-----ECTGHKDSVTHT 128

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
             S D     SG     +++W+ + G+    FE
Sbjct: 129 GFSHDSKLVASGDMSGMIKVWNASTGQEVWSFE 161



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 19/77 (24%), Positives = 33/77 (42%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +++L+ + D    +WK+   +       K    H    +  +   DG  A++G  D TL+
Sbjct: 175 NVLLAGTADGDTWMWKIPSGDT------KTFQSHGCRSTCGMFMKDGARAIAGYEDGTLK 228

Query: 305 LWDLAAGKTTRRFEDHT 355
           +WDL  G       D T
Sbjct: 229 VWDLKKGSNIFHLSDGT 245


>SB_20870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2032

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 4/85 (4%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYG 223
            KL+  +  H+  VT ++ + +    +++ SRD T  +W ++       +    P + LYG
Sbjct: 1807 KLQSRITAHSDTVTCLSID-RDGHHLMTGSRDTTCRLWLVSHVGGWAADVDKSPLQTLYG 1865

Query: 224  HSHFISDVVLSSDGNYALSGSWDKT 298
            H H ++ VVLS + + A+SGS D T
Sbjct: 1866 HDHEVTCVVLSWELDMAVSGSRDGT 1890



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            Q R+  HS  ++ + +  DG++ ++GS D T RLW
Sbjct: 1809 QSRITAHSDTVTCLSIDRDGHHLMTGSRDTTCRLW 1843


>SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32)
          Length = 458

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           + L L    +GHN  V Q+  +P  PD+ +++S DKT+ +W
Sbjct: 65  DRLTLDHIYKGHNESVDQLCWHPSNPDLFVTASGDKTIRIW 105



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVLS-SDGNYALSGSWDKTLR 304
           + S S D+T  V+ L +D     +    +Y GH+  +  +    S+ +  ++ S DKT+R
Sbjct: 48  LASGSFDRTASVFVLDKDR----LTLDHIYKGHNESVDQLCWHPSNPDLFVTASGDKTIR 103

Query: 305 LWD 313
           +WD
Sbjct: 104 IWD 106


>SB_51198| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1627

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 17/41 (41%), Positives = 26/41 (63%)
 Frame = +2

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*Q 367
            +VLS D + ALSG+  K L+LWD+ +G   +  E  ++V Q
Sbjct: 906  LVLSKDSSRALSGTLGKVLKLWDVQSGHVLKSIETSSEVGQ 946



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 4/88 (4%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +G N W   I+       +  SS   +T+ ++ L     N G  + +L GH+  I  + L
Sbjct: 1462 QGLNVWSVAISCESMRMVVTGSSGSGETMRIYDL-----NTGEFKHQLGGHTEPIKGLSL 1516

Query: 254  SSDGNYALS----GSWDKTLRLWDLAAG 325
            S DG   LS    G+ D+++ LWD+  G
Sbjct: 1517 SRDGRRLLSYVPMGTRDRSVCLWDVITG 1544


>SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 125 VSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 163


>SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0)
          Length = 1066

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           +K+ G    H+ ++  IA +P+ P  +L+SS D  + +W     +  +   Q    GH+H
Sbjct: 6   VKVHG-FEAHSDYLRSIAVHPQQP-YVLTSSDDMLIKLWDW---DKKWQCTQV-FEGHTH 59

Query: 233 FISDVVLS-SDGNYALSGSWDKTLR 304
           ++  +V++  D N   S S D+T++
Sbjct: 60  YVMQIVINPKDNNQFASASLDRTIK 84



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDHT 355
           HS ++  + +     Y L+ S D  ++LWD     + T+ FE HT
Sbjct: 14  HSDYLRSIAVHPQQPYVLTSSDDMLIKLWDWDKKWQCTQVFEGHT 58


>SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 362

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 12/44 (27%), Positives = 27/44 (61%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H + +S V +  + +  +S SWD+++++WDL + +  R  + H+
Sbjct: 86  HDNVVSSVSVDCEKSRIISASWDRSIKVWDLTSEQCIRTLKGHS 129



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           TL+GH+ +V  +  +    D+ LS+SRD ++++W
Sbjct: 124 TLKGHSDFVLGVDCSGTEKDLFLSASRDGSVVLW 157


>SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18)
          Length = 1764

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 3/73 (4%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNY---GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
            ++S +D  +++W  + D  +    G  Q  L    +     VLSS G YALS   DKT+ 
Sbjct: 1609 ITSHKDMRIVIWDHSNDNPDVVTLGTAQYVLPSTHYGCRVDVLSSGGRYALSHD-DKTIV 1667

Query: 305  LWDLAAGKTTRRF 343
            LWD+  G+    F
Sbjct: 1668 LWDVVDGRQVCTF 1680



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            L GHS  +  + +++DG+  +SGS D ++++W    G      ED
Sbjct: 1055 LVGHSKGVYGLAVTADGSCVVSGSEDGSVKVWSANDGSILVTIED 1099


>SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 459

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 22/70 (31%), Positives = 32/70 (45%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+S D T+ +W + R     G  Q  L  H   +  +  S DG Y  SGS+DK + +W  
Sbjct: 308 SASYDTTVRLWDVERG----GCLQV-LSKHHEPVYTISFSPDGRYLASGSFDKRVHIWST 362

Query: 317 AAGKTTRRFE 346
             G     F+
Sbjct: 363 QTGNLVHSFQ 372


>SB_46758| Best HMM Match : WD40 (HMM E-Value=5.8e-13)
          Length = 125

 Score = 35.9 bits (79), Expect = 0.027
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           L+GH+  +  V L      A +GS D+T+R+WD+A+G
Sbjct: 15  LFGHTGSVFCVDLDDAAKRAFTGSADRTVRIWDVASG 51


>SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2332

 Score = 35.9 bits (79), Expect = 0.027
 Identities = 21/77 (27%), Positives = 37/77 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++++RD ++ VW    D  N  I      GH   ++ + +   G+Y +SGS D T+R+W
Sbjct: 199 LITAARDGSIKVWD---DTGNVKII---FIGHLKAVNTLAIYPFGSYIMSGSSDNTIRVW 252

Query: 311 DLAAGKTTRRFEDHTKV 361
            L       R   +  V
Sbjct: 253 SLDMSDEVNRIHTNQPV 269


>SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10)
          Length = 345

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           YGH + IS + +S DG    +GSWD TLR+
Sbjct: 300 YGHDNRISCLKVSPDGTGICTGSWDNTLRM 329


>SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 482

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSS-RDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGN 268
           V  I  + +Y ++I S       LIVWK              L GHS  +  + +S DG 
Sbjct: 386 VCSILWSKEYKELISSHGYAQNQLIVWKYPSMTK-----MTELTGHSCRVLHMAMSPDGQ 440

Query: 269 YALSGSWDKTLRLWDLAAGKTTRR 340
             +S + D+TLRLW       T++
Sbjct: 441 TVVSAAADETLRLWKCFTTDPTKK 464



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           H+  +  +  S DG Y  SG  D  L +WD
Sbjct: 290 HTQEVCGLKWSPDGKYLASGGNDNLLNIWD 319


>SB_23694| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           GHS  +  V +   G +  +GS DK+++ W++A G+ T+
Sbjct: 31  GHSGMVRCVTVDPTGQWLATGSDDKSVKFWEVATGRCTK 69


>SB_18573| Best HMM Match : WD40 (HMM E-Value=1.5e-06)
          Length = 76

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 12/32 (37%), Positives = 21/32 (65%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +Y +S SWD+++RLWD  +G  +     H++V
Sbjct: 4   SYVISTSWDESIRLWDTTSGTCSLTLRGHSEV 35


>SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 390

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +2

Query: 164 VW-KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           VW + T +E N   P   L GH+  I+ +    DG + ++ S D+T++LWD+
Sbjct: 157 VWDRRTLNETN-PCPVGVLSGHADGITCIASKGDGRHLITNSKDQTIKLWDI 207



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI 202
           G L GH   +T IA+      +I ++S+D+T+ +W + +  +N GI
Sbjct: 172 GVLSGHADGITCIASKGDGRHLI-TNSKDQTIKLWDIRKFSDNDGI 216


>SB_46905| Best HMM Match : WD40 (HMM E-Value=8.9e-12)
          Length = 340

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           GHS  ++ + ++ DG   LSGS D T R+W + + ++ R
Sbjct: 171 GHSKQVTSLAVTMDGTVLLSGSNDNTARVWHIQSRQSIR 209


>SB_8327| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 550

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 7/113 (6%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGI--PQK 211
           +ET  L+ TL+GH   V  I+ +      ++S S D  +I+W          Y I  P  
Sbjct: 49  TETGSLQHTLKGHTSQVVGISADTTNELQVISCSGDGQVIMWDFMDGAILKKYEIDAPVF 108

Query: 212 RLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           RLY    H H I  V+      Y L+    KT+ L D    + T   + H+++
Sbjct: 109 RLYTHPAHEHSIFPVIKDETRKYQLARFNTKTMDL-DEEVEQVTDLNDSHSQL 160


>SB_14705| Best HMM Match : WD40 (HMM E-Value=3.6e-20)
          Length = 215

 Score = 34.3 bits (75), Expect = 0.082
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L+ S DKT+ +W    D  N       L GH+ ++  +    +    ++ ++D T+R WD
Sbjct: 127 LTCSDDKTICLW----DARNLKSNVFSLVGHTSWVKSIEYCRESGKLVTSAFDDTIRTWD 182

Query: 314 L 316
           L
Sbjct: 183 L 183


>SB_1661| Best HMM Match : WD40 (HMM E-Value=5e-13)
          Length = 106

 Score = 34.3 bits (75), Expect = 0.082
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           L GHS  I     +S G   L+GS+D T+ +WD  +G+
Sbjct: 19  LSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGR 56


>SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23)
          Length = 437

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LYGH   +  + +SSD    ++GS DK +++W L  G   +    H
Sbjct: 242 LYGHKLPVMAMDISSDSTLIVTGSADKNIKIWGLDFGDCHKSIFSH 287


>SB_5728| Best HMM Match : Band_41 (HMM E-Value=1e-26)
          Length = 906

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 21/77 (27%), Positives = 39/77 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+  +T   T+P    +I++SS D T  +W   R  + + +      GHS  +     S
Sbjct: 267 GHDQELTHTCTHPSQ-QLIVTSSTDTTFRLWDF-RTPSIHSV--NVFQGHSDTVRSTAFS 322

Query: 257 SDGNYALSGSWDKTLRL 307
           +  +  +SGS D+T+++
Sbjct: 323 TTKDIVVSGSDDRTVKV 339


>SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35)
          Length = 844

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           ++  GH+   S + +S DG    +G  D T+R WDL  G+  ++ +  +++
Sbjct: 463 RQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 513


>SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30)
          Length = 1292

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 18/74 (24%), Positives = 34/74 (45%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I++SS D T  +W +   +           GH+  +  + L+ +    +SG+ D + +LW
Sbjct: 86  IITSSGDMTCALWDIETAQTI-----STYSGHTGDVMSLSLNPNNQSFVSGACDASAKLW 140

Query: 311 DLAAGKTTRRFEDH 352
           D+  G   + F  H
Sbjct: 141 DIRGGTCVQTFTGH 154



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 26/92 (28%), Positives = 39/92 (42%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   T  GH G V  ++ NP     + S + D +  +W +       G   +   GH
Sbjct: 101 ETAQTISTYSGHTGDVMSLSLNPNNQSFV-SGACDASAKLWDI-----RGGTCVQTFTGH 154

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
              I+ V     G    +GS D T RL+D+ A
Sbjct: 155 ESDINAVAFFPSGFAFGTGSDDATCRLFDIRA 186


>SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 475

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + + K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 305 TRQTNSNKAAHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 359

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 360 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 396



 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           GH   ++  + NP  P ++ S S D  + VW++  +  N
Sbjct: 420 GHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQMAENIYN 458


>SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36)
          Length = 885

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 3/97 (3%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFIS 241
           G L GH   V  ++ +P+   ++LS S D  + +W L T+D        + +  H  F+ 
Sbjct: 60  GALDGHTDGVNCLSRHPRSLSVLLSGSCDGEVKLWNLPTKD------CLRTITAHKGFVR 113

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDL--AAGKTTRRFE 346
            + +   G   +S   DK ++ W +  A   TT + E
Sbjct: 114 GLCVDHTGQSFISVGDDKIVKQWSMSNALDGTTTKLE 150


>SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30)
          Length = 685

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L GH+  +  + +S DG Y  S + D+TLRLW
Sbjct: 624 LTGHTSRVLCMAMSPDGQYVASAAADETLRLW 655


>SB_7988| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L GH+  +  + +S DG Y  S + D+TLRLW
Sbjct: 7   LTGHTSRVLCMAMSPDGQYVASAAADETLRLW 38


>SB_17662| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           D     I QK + GH+  +  V+   + +  +S SWDKT+R+W+       R  +D+
Sbjct: 122 DPETRKIVQKNV-GHTDSVRCVMHIPERSQYISASWDKTVRIWNAFKNSRKRSTKDN 177



 Score = 25.4 bits (53), Expect(2) = 6.9
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQI--ATNPKYPDMILSSSRDK 154
           FS     +KL   L+GH   VTQI   T P    +  SS R+K
Sbjct: 26  FSDKGREMKLLAVLQGHEADVTQIFSGTTPCELQVRWSSVRNK 68



 Score = 21.0 bits (42), Expect(2) = 6.9
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWD 313
           SS  N  ++GS D T+R+W+
Sbjct: 63  SSVRNKWVTGSEDGTIRVWN 82


>SB_10188| Best HMM Match : WD40 (HMM E-Value=0.046)
          Length = 53

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H H +  V  SSDG   L+GS +K LR++DL
Sbjct: 17  HKHIVKTVDFSSDGIRLLTGSNEKILRIFDL 47


>SB_51892| Best HMM Match : WD40 (HMM E-Value=8.7e-14)
          Length = 353

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +  GH G + Q+  NP YP+  L+ S D ++ +W   R
Sbjct: 110 SFHGHTGPIYQVKWNPLYPEAFLTCSADWSVRLWHCDR 147


>SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 359

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  GHS  +       D  + +S S DK +  WD+A  +TT  +++H
Sbjct: 117 RQFKGHSGPVHVTKFLQDNLHIVSASDDKLVNCWDIATEQTTATYKEH 164


>SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 525

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 25/96 (26%), Positives = 43/96 (44%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G L+GH+  V  I  +P   ++I S+  D  +I+W + R+          L GH   I  
Sbjct: 132 GHLQGHDRKVGIIRWHPCASNIIASAGFDDVIIIWDVERE-----AAVLILKGHPDTIFS 186

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  + +G+   +   DK +R+ D   G+     E H
Sbjct: 187 LSFNWNGSLIATTCKDKKIRVIDPREGRLIASGEGH 222



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +2

Query: 104 ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALS 280
           A NPK+  + L SS     +V  L++        Q ++ GH+  + D+  +  D N   S
Sbjct: 45  AVNPKFLAVALESSCGGPFLVLPLSQTGKIDPFNQPKVNGHTRPVLDLGWNPFDDNVIAS 104

Query: 281 GSWDKTLRLW 310
            S D ++++W
Sbjct: 105 ASEDCSIKIW 114


>SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 645

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 24/87 (27%), Positives = 43/87 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K +GT  GH G V  +     + +++ S S DKT+ +W +   E         ++GH + 
Sbjct: 451 KCKGTFVGHTGPVWALCV---HGELLFSGSSDKTIKIWSIETLE-----LLDSIHGHENP 502

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +  +V  +  N   SGS  K +++W+L
Sbjct: 503 VCTLV--TKRNILFSGSL-KKIKVWNL 526


>SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2051

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
            GHS  +  + +    +Y LS S DKT++LW L+
Sbjct: 1736 GHSGAVRSLCIQDSEHYFLSASKDKTVKLWSLS 1768



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 24/90 (26%), Positives = 36/90 (40%), Gaps = 2/90 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN--YGIPQKRLYGHSHFIS 241
            T  GH+G V  +          LS+S+DKT+ +W L+               Y HS  + 
Sbjct: 1733 TFTGHSGAVRSLCIQDS-EHYFLSASKDKTVKLWSLSNHGGGTAQSASSCTYYHHSRGVF 1791

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
             V +      A   S D T+ +WD  +  T
Sbjct: 1792 AVDMVESVRQA--ASCDGTVHIWDPVSAST 1819


>SB_5414| Best HMM Match : WD40 (HMM E-Value=6.6e-15)
          Length = 490

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           SG S       K+S+  +    LRGH G VT +   P+    +++ S D T+ +W++ R
Sbjct: 92  SGSSDNNAYIWKVSDADRPPVCLRGHAGEVTSVVWCPQDITKVVTCSDDTTVRIWRMNR 150



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = +2

Query: 221 GHSH--FISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           GHS+  F     LS D NY LSGS D    +W ++
Sbjct: 71  GHSNSTFYVKAALSPDDNYLLSGSSDNNAYIWKVS 105


>SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 544

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +2

Query: 95  TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG----HSHFISDVVLSSD 262
           T++  +P     I + +   T+ V+K+++ ++  G      +     H   I ++ ++S+
Sbjct: 151 TKVNFSPDSRAFITALANGNTIRVFKVSKKKDGTGTTITGEFDFPVRHKAEIINIAVASN 210

Query: 263 GNYALSGSWDKTLRLWDL 316
           G Y +S S D T+ +WDL
Sbjct: 211 GKYIMSCSKDTTIIIWDL 228



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GH+  + D+  S +G    S S D+T+RLW +
Sbjct: 97  LKGHTSEVLDLDFSLNGKLLASTSQDRTVRLWSV 130


>SB_36772| Best HMM Match : WD40 (HMM E-Value=3.8e-05)
          Length = 788

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDL 316
           S DGN+ +S S DK LR+WDL
Sbjct: 536 SRDGNHFISSSNDKLLRIWDL 556



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           S DG+  +S S D ++ LW++A G+  R  E
Sbjct: 347 SDDGSLVVSASSDNSVNLWNVATGRLVRSIE 377


>SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1308

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH+  +  IA  P+ PD+++S ++D  ++ W
Sbjct: 257 LEGHSRGILSIAWCPQDPDLLMSCAKDNRILCW 289



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           H+G V  +  NP  P+++ S + D  + +W +
Sbjct: 122 HSGAVQALDFNPFQPNLLASGASDSEIFIWDM 153


>SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13)
          Length = 232

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           GHS  I  + + +DG   ++GS D T+R+WD++
Sbjct: 174 GHSKMILCLDVCADGTKIVTGSKDHTVRVWDVS 206


>SB_39216| Best HMM Match : WD40 (HMM E-Value=1.1e-14)
          Length = 867

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 21/85 (24%), Positives = 40/85 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH      +  +P   +++ S++ D T+ +W +   ++        L GH+  +  +  S
Sbjct: 108 GHYDKPNIVRYHPNAENLLTSAAYDLTVKLWDINAAKSVI-----TLEGHNEQVFSLAWS 162

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKT 331
           +DG    + S DK LR++D  A  T
Sbjct: 163 ADGKQLATFSRDKKLRIYDPRAQVT 187



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           N   S ++D T++LWD+ A K+    E H +
Sbjct: 124 NLLTSAAYDLTVKLWDINAAKSVITLEGHNE 154


>SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 428

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           L GH+  +  V  +S  +  ++GS   TL++WDL A K
Sbjct: 57  LAGHTSPVECVQFNSGEDLVVAGSQSGTLKIWDLEAAK 94


>SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 998

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           L GH   V  +  NP  P M+ S+S D T+ +W  + +E +
Sbjct: 243 LCGHTRTVNCVTWNPLVPSMMASASDDGTVRIWGPSTEETS 283


>SB_43688| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1200

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +3

Query: 255  LVTVITPFPVLGTRLCVCGISLQARLPDDSRTILRCDRTLNF 380
            LV ++   P L     VCG+S+  R PDDS  +  C   L+F
Sbjct: 1037 LVELVDLMPTLAE---VCGLSVPDRCPDDSSKVTVCTEGLSF 1075


>SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11)
          Length = 256

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           GH+  I  +  S DG    SG  D  +R+WD    + T
Sbjct: 179 GHTDTIHTMSFSPDGTLLASGGMDGAVRVWDFGQVRNT 216


>SB_20702| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/40 (30%), Positives = 23/40 (57%)
 Frame = -3

Query: 358 LSMVLESSGSLACSEIPQTQSLVPRTGKGVITVTRQHNIR 239
           ++  + S GSL   +I +   ++P TG GV+++    N+R
Sbjct: 20  IAQKVSSIGSLTTLKITERAEILPETGNGVVSIGSAMNVR 59


>SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22)
          Length = 453

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 13/48 (27%), Positives = 22/48 (45%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           F       +L   L  H   +T IA NP   D++ S+  D  +++W +
Sbjct: 44  FDHQFSEYRLISILADHRKTITAIAWNPHNEDILASAGADCRVLIWSI 91


>SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1845

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 25/95 (26%), Positives = 42/95 (44%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH G V  I     Y   + + S DKT   + +       G   K   GH + ++ + +S
Sbjct: 1325 GHTGAVCAIKACDGY---LYTCSADKTTKAFDIQT-----GNCVKVYDGHHNAVNCLEIS 1376

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             D     +GS D+T+R +++     T +F  H +V
Sbjct: 1377 EDRTRLFTGSNDQTVRSYNVKTAVCTHKFTFHGRV 1411


>SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4865

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +2

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTR 337
           D N  L+G WD+ L++WD+      R
Sbjct: 21  DDNVFLTGGWDRCLKIWDVRVDHVIR 46


>SB_40171| Best HMM Match : WD40 (HMM E-Value=0.00071)
          Length = 155

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = +2

Query: 221 GHSH--FISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           GHS+  F     LS D NY LSGS D    +W ++
Sbjct: 93  GHSNSTFYVKAALSPDDNYLLSGSSDNNAYIWKVS 127


>SB_7214| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 505

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 4/64 (6%)
 Frame = -2

Query: 545 DGRYIYNTIIILPSYLRL--LQHKHNLLPRKGTKH--WSSASHRHLGLSSVHNQHLHPNK 378
           D    Y+T  I  S++RL  +QH H  LP     H    S  H H+ L    + H+    
Sbjct: 118 DSTLTYSTPSIQHSHIRLPSIQHSHIRLPSTQHTHIRLHSTQHTHIRLHLTQHSHIRLPS 177

Query: 377 IKSS 366
           I+ S
Sbjct: 178 IQHS 181


>SB_44622| Best HMM Match : dsrm (HMM E-Value=3.1e-16)
          Length = 724

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNY-ALSGSW--DKTLRLWDLAAGKTTRRFE 346
           ++++G  H   D +     N+  L+GSW  D TL++WD  +GK  +  +
Sbjct: 618 RKIFG-PHICGDALDIHPMNFNILTGSWRKDDTLQIWDYGSGKMIKSIQ 665


>SB_14873| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 296

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  ++ + +S   +  +SGS D TLR+WDL
Sbjct: 220 GHTKRVTTLHMSPVEDTFVSGSLDCTLRIWDL 251


>SB_13993| Best HMM Match : WD40 (HMM E-Value=2.6e-10)
          Length = 73

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = +2

Query: 209 KRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           KR Y GH   I+ +V S    Y  + S+D+TLR+WD
Sbjct: 21  KRTYKGHESAINCLVASKGKLY--TASYDRTLRIWD 54


>SB_13850| Best HMM Match : WD40 (HMM E-Value=3.1e-06)
          Length = 229

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           N   S ++D T++LWD+ A K+    E H +
Sbjct: 198 NLLTSAAYDLTVKLWDINAAKSVITLEGHNE 228


>SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21)
          Length = 447

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           +L GH+  VTQIA +      ILS SRD++  V++L +D+
Sbjct: 244 SLPGHSLTVTQIAFSHS-GQRILSVSRDRSWAVFRLRQDD 282


>SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/52 (26%), Positives = 21/52 (40%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           G  +  L     F   +  S DG+Y   G+ D  + ++DL   K     E H
Sbjct: 96  GKKESSLDTRGKFTMSLAYSPDGHYIACGAIDGIINIFDLTTNKLLHTLEGH 147


>SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18)
          Length = 659

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GHS  +  VV+SS  +   SG  D T+  W++
Sbjct: 396 GHSAAVLSVVISSTSDMCFSGGADGTILCWNI 427


>SB_9603| Best HMM Match : Extensin_2 (HMM E-Value=0.0058)
          Length = 339

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = -2

Query: 503 YLRLLQHKHNLLPRKGTKHWSSASH-RHLGLSSVHNQHL 390
           +L    H H+L      +H S++SH RHL  SS H +HL
Sbjct: 195 HLSTSSHVHHLSTSSHVRHLSTSSHVRHLSTSS-HVRHL 232


>SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22)
          Length = 874

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S T +  G L+GHNG V Q+  + +    I+S   D  +  W +     NY    + +  
Sbjct: 261 STTFENVGNLKGHNGKVRQVIWS-QDDSKIISCGMDGAVYEWNV----YNYKREGESVLK 315

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLR 304
              + S V +S DG    +   D+T++
Sbjct: 316 SCSYTS-VTVSPDGRTTFAVGSDRTIK 341


>SB_47704| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 296

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S   Y L G   KTL  WD+ +    + ++DH
Sbjct: 49  NSTSRYLLLGGKTKTLTAWDVRSKSVKKTYKDH 81


>SB_47471| Best HMM Match : WD40 (HMM E-Value=0.014)
          Length = 117

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           L G   ++ DV  SSD     SGS D+T+R+   A  K  R
Sbjct: 18  LGGQYDWVMDVACSSDWAMLTSGSCDQTVRVLSCATLKKAR 58


>SB_34704| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 53

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDK 154
           +L  TLRGHNG V+ IA N +   ++ + S DK
Sbjct: 22  RLLATLRGHNGEVSDIAINYE-NTLVAAGSCDK 53


>SB_46184| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 96

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           + ++TR + NY +P KR+   + FI   V + +G++
Sbjct: 6   ITRITRKKPNYALPHKRVIPEALFIRTPVNTDNGHF 41


>SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 559

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIV--WKLTRD--ENNYGIPQKRLYGH 226
           TLR H   + Q+A + +YP +  S+S D T+I+    +  D  +N   +P K L GH
Sbjct: 106 TLRSHKKALRQVAFHKRYP-LFASASDDGTVIISHGMVYNDLMQNPLLVPVKILRGH 161


>SB_45184| Best HMM Match : C2 (HMM E-Value=1.1e-22)
          Length = 344

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -3

Query: 415 YLQCIISIYTLTKLRVLSHLSMVLESSGSLACSEIPQTQSLVPRTGKGVITVTR 254
           +L C  +IY++ K R  +++S +L +  +L      + ++L    G+  +TV R
Sbjct: 4   FLACDSTIYSVYKFRNATYISAILATLATLVAIGYDRFEALTKFPGQRKLTVRR 57


>SB_35960| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 843

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = -2

Query: 533 IYNTIIILPSYLRLLQHKHNLLPRKGTKHWSSASHRHL 420
           +YN   + P  +RLL  + N   R+   HW   SH  L
Sbjct: 482 LYNQTSLGPRAVRLLHPQQNAEERRVGVHWRRRSHHRL 519


>SB_54936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 182

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           GH+  +  V + S G    SGS D+T+R+
Sbjct: 12  GHAGCVKSVAVDSSGTLLASGSTDETIRI 40


>SB_42985| Best HMM Match : MRJP (HMM E-Value=3.9)
          Length = 317

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 10/33 (30%), Positives = 19/33 (57%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S+G Y  S S DK++ +W++ +     + + HT
Sbjct: 239 SEGRYIYSTSQDKSIVVWEVTSQGVVAKLQGHT 271


>SB_41604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 406

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -3

Query: 415 YLQCIISIYTLTKLRVLSHLSMVLESSGSLACSEIPQTQSLVPRTGKGVITVTR 254
           +L C  +IY++ K R  +++S +L +  +L      + ++L    G+  +TV R
Sbjct: 4   FLACDSTIYSVYKFRNATYISAILATLATLVAIGYDRFEALTKFPGQRKLTVRR 57


>SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 38

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGK 328
           S DG+Y +SG  D  L +WD  + K
Sbjct: 11  SPDGSYVISGDADGKLNIWDWKSTK 35


>SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24)
          Length = 298

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -1

Query: 360 TLVWSSNRLVVLPAARSHKRKVLSQEPERA*LPS 259
           TL WSS RL+  P AR H   + ++  ++   PS
Sbjct: 225 TLTWSSERLMNEPYARGHSSTLPARTKDKKASPS 258


>SB_57522| Best HMM Match : F5_F8_type_C (HMM E-Value=0.004)
          Length = 209

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = +2

Query: 221 GHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           G S  I++VV+++ DG Y     WDKT  L
Sbjct: 121 GSSQPIAEVVITNRDGTYGTQRLWDKTFEL 150


>SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014)
          Length = 230

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/45 (26%), Positives = 22/45 (48%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +G    I+ + + +D NY +S + D +L  WDL   +    +  H
Sbjct: 164 HGKGAPITCIRVLNDDNYVISSAMDGSLMRWDLRVSRPVLAYLGH 208


>SB_19699| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 716

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%)
 Frame = +2

Query: 83  NGW--VTQIATNPKYPDMILSSSRDKTLIVWK 172
           +GW   T  A N  YP M LSS+ D  L  W+
Sbjct: 477 HGWNSFTLAAVNITYPVMFLSSTIDPVLYCWR 508


>SB_7596| Best HMM Match : WD40 (HMM E-Value=7.1e-15)
          Length = 291

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = +2

Query: 116 KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDK 295
           K   ++++SS+D  + +W L  D  +  +    L GHS  +    L+ +    ++G  D 
Sbjct: 121 KEKSVLVTSSKDMLVKMWDL--DTQHCFLT---LVGHSSEVWSFTLARNERRLVTGCGDS 175

Query: 296 TLRLWDL 316
            LR+W++
Sbjct: 176 ELRVWEV 182


>SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1855

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 10/33 (30%), Positives = 18/33 (54%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           GH   ++  + NP  P ++ S S D  + VW++
Sbjct: 900 GHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQM 932


>SB_48230| Best HMM Match : DUF152 (HMM E-Value=1.5)
          Length = 579

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -1

Query: 360 TLVWSSNRLVVLPAARSHKRKVLSQEPERA*LPS 259
           TL WSS RL+  P AR H   + ++  ++   PS
Sbjct: 74  TLTWSSERLMNEPYARGHSSTLPARTKDKKPSPS 107


>SB_27500| Best HMM Match : WD40 (HMM E-Value=3.5e-05)
          Length = 196

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/45 (26%), Positives = 22/45 (48%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +G    I+ + + +D NY +S + D +L  WDL   +    +  H
Sbjct: 66  HGKGAPITCIRVLNDDNYVISSAMDGSLMRWDLRVSRPVLAYLGH 110


>SB_1087| Best HMM Match : HEAT (HMM E-Value=2.7)
          Length = 219

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = +3

Query: 285 LGTRLCVCGISLQARLPDDSRTIL 356
           +G  LC  G  LQA LP DS  IL
Sbjct: 109 MGQILCTFGDELQAELPSDSMPIL 132


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,761,956
Number of Sequences: 59808
Number of extensions: 378257
Number of successful extensions: 1408
Number of sequences better than 10.0: 127
Number of HSP's better than 10.0 without gapping: 1041
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1360
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1560464625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -