SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38)                112   2e-25
SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.)             102   2e-22
SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36)                  80   1e-15
SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16)                   75   4e-14
SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.)               71   9e-13
SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   2e-11
SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18)                 64   6e-11
SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   6e-10
SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0)                       60   1e-09
SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   7e-08
SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.)               52   3e-07
SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24)                 50   2e-06
SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25)                 49   2e-06
SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)                49   3e-06
SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   3e-06
SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33)                 48   6e-06
SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   4e-05
SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0)                       45   5e-05
SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24)                 44   1e-04
SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0)                       43   2e-04
SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18)                   42   3e-04
SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0)                       42   3e-04
SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)                     42   4e-04
SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0)               41   9e-04
SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18)                 41   9e-04
SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)                41   9e-04
SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.001
SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)                  40   0.001
SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28)                 40   0.002
SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11)                  39   0.003
SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39)                 38   0.005
SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07)                 38   0.006
SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.)                38   0.008
SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0)                        38   0.008
SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.014
SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07)                  37   0.014
SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.019
SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42)             36   0.032
SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69)                    36   0.032
SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.043
SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013)                   34   0.075
SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.075
SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035)                 34   0.099
SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.17 
SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21)                 33   0.23 
SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.53 
SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.53 
SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.53 
SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.70 
SB_3721| Best HMM Match : RRM_1 (HMM E-Value=3.1)                      31   0.70 
SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017)                   31   0.92 
SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13)                 31   0.92 
SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35)                 30   1.2  
SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.2  
SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23)                    30   1.2  
SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_4929| Best HMM Match : C2 (HMM E-Value=2.4e-33)                     30   1.6  
SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.1  
SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0)                        29   2.8  
SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13)                     28   4.9  
SB_53221| Best HMM Match : zf-CCHC (HMM E-Value=0.061)                 28   6.5  
SB_38068| Best HMM Match : UreE_N (HMM E-Value=0.46)                   28   6.5  
SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05)               27   8.6  
SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7)                     27   8.6  

>SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38)
          Length = 496

 Score =  112 bits (269), Expect = 2e-25
 Identities = 57/132 (43%), Positives = 80/132 (60%), Gaps = 2/132 (1%)
 Frame = +2

Query: 68  MDDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           M + EK  K+F+GGL+W T++E L+ YFS++G ++DCV+MK    GRSRGFGFVT+    
Sbjct: 43  MSESEKLRKIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMK--RDGRSRGFGFVTYESSD 100

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            VN VL+   H LD R I+PK   PR     P+      K+F+GGL S   E D++  F 
Sbjct: 101 SVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFN 160

Query: 422 TLWEGHGGGHYV 457
           +L   +G G  +
Sbjct: 161 SLCRKNGMGEVI 172



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 7/91 (7%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRY------GEVIDCVVMKNSESG-RSRGFGFVTFADPSL 247
           K+FVGGL+  T +E+++ YF+        GEVID  + ++ ++  R RGF FVTF +  +
Sbjct: 140 KIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEI 199

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
           V  V     H++  +  + K   P++  + K
Sbjct: 200 VEKVCAMKYHEIRMKQCEVKKAEPQSAMRKK 230


>SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 299

 Score =  102 bits (244), Expect = 2e-22
 Identities = 51/125 (40%), Positives = 77/125 (61%), Gaps = 4/125 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++D + KLFVGGL+ ET+ E L+ YF  YGE+ D VV+ +S + +SRGFG+VTFAD  + 
Sbjct: 9   NNDPRAKLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVT 68

Query: 251 NLVL----QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             VL    +NG H++DG+ ++ K   PR            K+F+GGLP + T+ D++   
Sbjct: 69  RNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKKIFVGGLPEDATKEDIQEAI 128

Query: 419 RTLWE 433
            +L E
Sbjct: 129 ESLLE 133



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 3/100 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYF-SRYGEVIDCV--VMKNSESGRSRGFGFVT 229
           N     ++  K+FVGGL  + ++E++Q    S   E +D V  +MK  +  + RGF FV 
Sbjct: 99  NSATSHEKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVE 158

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
             +    + +       + G+ ++ K   PR    P  GG
Sbjct: 159 LNNEDQADELCCVKKIHVKGKMVEAKKATPRDRNSPADGG 198



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           + G +R         +F  YG++ +VV++ D   KKS G G+++F D
Sbjct: 18  VGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFAD 64


>SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36)
          Length = 328

 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 46/115 (40%), Positives = 66/115 (57%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD+ GKLFVGGLS+ET++E+L+ YFS+YGE++   +  ++ +GR RGF FV F       
Sbjct: 25  DDDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQF------- 77

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
                  HQ +   IDPKP  P  + KP       K+F+GGL    ++  +R  F
Sbjct: 78  ------KHQSEADAIDPKPAAP--IGKPPH-LRVKKIFVGGLKPETSDEKIREYF 123



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSR-YGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           K+FVGGL  ETS E ++ YF + Y  V +   +    S R RGF FV+F     V+ + +
Sbjct: 104 KIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICE 163

Query: 266 NGPHQLDGRTIDPKPCNPRTLQK 334
              H ++G  ++ K   P+ +Q+
Sbjct: 164 TQFHNIEGNKVEVKRALPKEVQQ 186


>SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16)
          Length = 842

 Score = 74.9 bits (176), Expect = 4e-14
 Identities = 39/101 (38%), Positives = 63/101 (62%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRT 295
           + S E L+++F ++GE+ +CVVM++  + RSRGFGF+TF DP  V++VL +G  +LDG+ 
Sbjct: 118 QASAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKK 177

Query: 296 IDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +        T  K        K+F+GGL +N +E D++  F
Sbjct: 178 M-------VTTTK--------KIFIGGLSTNTSEEDMKKYF 203



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 14/26 (53%), Positives = 24/26 (92%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEV 166
           K+F+GGLS  TS+E++++YFS++G+V
Sbjct: 184 KIFIGGLSTNTSEEDMKKYFSQFGKV 209



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 14/31 (45%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F ++G++ E V+M D   K+S G GFL+F+D
Sbjct: 128 FEKFGELKECVVMRDPVTKRSRGFGFLTFKD 158


>SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score = 70.5 bits (165), Expect = 9e-13
 Identities = 39/83 (46%), Positives = 47/83 (56%), Gaps = 11/83 (13%)
 Frame = +2

Query: 209 RGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR----------TLQKPKRGGGYP 358
           +GFGFVTF DP+ +  VL   PH LDG+TIDPKP  PR           +  P+RG    
Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201

Query: 359 -KVFLGGLPSNVTETDLRXIFRT 424
            KVF+GGL    TE DL+  F T
Sbjct: 202 GKVFIGGLAFGTTEEDLKEYFST 224



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEV 166
           P       GK+F+GGL++ T++E+L+ YFS YG V
Sbjct: 194 PQRGSANDGKVFIGGLAFGTTEEDLKEYFSTYGMV 228


>SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 435

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 43/117 (36%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           G L V GL + T++  ++ YF+R+GE+  C V  +  + RSRGFGFV F        VL 
Sbjct: 115 GDLIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLS 174

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
              H++ GR      C  R L +PK     P K+F+G LP + TE  L   F    E
Sbjct: 175 TS-HRIQGRL-----CEVR-LPRPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGE 224



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           KLFVG L   T+++ L  YF+++GEV D  + K       R FGFVTFA   + V++  +
Sbjct: 200 KLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPK-----PFRHFGFVTFASVANCVSIAFE 254

Query: 266 N 268
           N
Sbjct: 255 N 255


>SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18)
          Length = 291

 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 30/91 (32%), Positives = 53/91 (58%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  KLFVGG+ +E+  + L+++F+++GE+ + VV+K+  + +S+G+GFVT A      
Sbjct: 6   DTKFTKLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAE 65

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
           L  +N    ++GR  +          KP RG
Sbjct: 66  LACKNKRPMIEGRQANVNLAYLGAKPKPTRG 96



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           FF ++G++ E V++ D+  KKS G GF++
Sbjct: 29  FFAQFGEIREAVVIKDRVTKKSKGYGFVT 57


>SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 314

 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 6/125 (4%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGE----VIDCVVMKNSESGRSRGFGFVTFAD 238
           DD +  KLFVGGL+ +T++E ++ YF  + E     +  V +  +  G+SR F FV F++
Sbjct: 3   DDSKLMKLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVSLAKTPEGKSRKFCFVEFSN 62

Query: 239 PS--LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
            S  + N+V     H +D + ++ K   PR            K+F+GGL    +E D++ 
Sbjct: 63  GSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPNELAHVRTKKLFIGGLKDEHSEEDVKT 122

Query: 413 IFRTL 427
               L
Sbjct: 123 ALAPL 127



 Score = 27.9 bits (59), Expect = 6.5
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIFRTLWEG 436
           K+F+GGL  + TE  +R  F++  EG
Sbjct: 9   KLFVGGLNEDTTEETVRAYFKSFCEG 34


>SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 420

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 41/122 (33%), Positives = 64/122 (52%), Gaps = 2/122 (1%)
 Frame = +2

Query: 62  PDMDDDEKGK--LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           P   D EK    +FVGGL+  T +E L+ YF ++GEV    +M+ +  G SR +GFV F 
Sbjct: 70  PSPKDIEKNSRSVFVGGLASGTDEEGLKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLFK 128

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
           D      VL+   H ++G+T+D             +   +  +++GGLPS+ TE  +R  
Sbjct: 129 DDGPSKEVLKKS-HVINGKTVD-----------VGKSRNFRVIYVGGLPSHFTEQTVREH 176

Query: 416 FR 421
           F+
Sbjct: 177 FK 178



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           LFV  LS +T + ++ RYF  YG+V    ++ + E+G+S+G G V    P  VN +L+  
Sbjct: 321 LFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEP 380

Query: 272 PH 277
            H
Sbjct: 381 VH 382



 Score = 32.3 bits (70), Expect = 0.30
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 3/114 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL V  L ++T+ + L+ YF + GE+    ++ NSE        F  F +   +  V++ 
Sbjct: 237 KLMVQDLDFDTTVDELREYFEKCGELTGIDLLINSEKRTCAAIVF--FRNLKDIKKVVEE 294

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP---KRGGGYPKVFLGGLPSNVTETDLRXIFR 421
             H + G  +       RT+Q P   K+G     +F+  L  +  E D+   FR
Sbjct: 295 N-HTIKGLKV-------RTVQLPNEEKQGVRERTLFVDNLSEDTKELDVLRYFR 340


>SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 364

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 32/98 (32%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADP 241
           D+   E+ K ++G L ++ ++ +LQ  FSRY +V+D  V+ + E+ R RGF FVTF +  
Sbjct: 223 DLKMGEECKCYIGNLDFKVNEADLQDRFSRY-DVVDVQVISDRETQRPRGFAFVTFGSKK 281

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
           ++ + + +    + DGR++       R  +   RGGGY
Sbjct: 282 NMEDAINELDGQEFDGRSMKVNQARSREQRGGGRGGGY 319



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +2

Query: 179 VMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGG 352
           V+ + E+GR RGFGFVTF     ++  +     + DG  +D +P      Q + +RGGG
Sbjct: 40  VITDRETGRPRGFGFVTFGSEDEMDKAID----KFDGEDLDGRPMKVNKAQPRGERGGG 94


>SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 732

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 32/91 (35%), Positives = 44/91 (48%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+  +F+G LS++  +E L  +F   G    C V+  ++ GRSRGFG+  F      N  
Sbjct: 178 EEMSVFLGNLSFDADEETLAAFFEEKGLSATCRVI--TQEGRSRGFGYADFTSKEDYNKA 235

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
           L+       GR I   P N     KP RGGG
Sbjct: 236 LELNGEDCCGREIRINPAN----SKPSRGGG 262



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-QN 268
           L V  LS++T+ ++L   F       +  V+ + ESG SRGFGFV + D      VL + 
Sbjct: 291 LIVRNLSYDTTTDSLGAAFEGCS---NAKVIFDRESGESRGFGFVDYDDVETAKKVLSEM 347

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
              ++DGR +     +PRT +   RGGG
Sbjct: 348 AGAEVDGRQVRLDFASPRT-EGGGRGGG 374


>SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 215

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLV 259
           K  ++VG L +  +  +L + F RYG+V+   ++++ E+  SRG  F+ F D  S  N V
Sbjct: 9   KSTVYVGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAV 68

Query: 260 LQNGPHQLDGRTI 298
                 Q+ GRTI
Sbjct: 69  AAVNKKQMFGRTI 81


>SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24)
          Length = 343

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 2/127 (1%)
 Frame = +2

Query: 59  NPDMD--DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +P MD  +  +  +FVG L   T +  +  YFS  GE ++ V    + SG+S+GF FV  
Sbjct: 31  SPSMDLLEQSRRTIFVGSLHPSTVESTIFEYFSTLGEQVEHVKCIRTLSGKSKGFAFVRL 90

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                V  VL    H +D   +        +++K      Y KV L  +PS++ E+ +  
Sbjct: 91  RKKEAVESVLGRDDHVIDNSDV--------SMEKQDT---YRKVILKNIPSSIGESQILE 139

Query: 413 IFRTLWE 433
            F +  E
Sbjct: 140 HFSSSGE 146



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 26/111 (23%), Positives = 48/111 (43%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   K+ +  +     +  +  +FS  GE+    + +N ++   +G   VTFA  +    
Sbjct: 118 DTYRKVILKNIPSSIGESQILEHFSSSGEIASVYIPENLKTKERKGHCIVTFASVTEAFE 177

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLR 409
           V++   H + G  I  +      L++PK      K+ L  LP NVT   ++
Sbjct: 178 VVKKRKHHIHGYDIITE--YYMNLKQPK------KLCLKNLPYNVTVDQIK 220


>SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25)
          Length = 159

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ + ++G LS+   ++ L+  F    +V+D  V+ + E+GR RGFGFVTF         
Sbjct: 3   EEYRCYIGNLSYSVDEQALEEKFHGC-DVVDVKVITDRETGRPRGFGFVTFGSKE----E 57

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGG 352
           ++    + DG+  D +P      Q + +RG G
Sbjct: 58  MEKAIDEFDGQDFDGRPMKVNQAQPRGERGAG 89


>SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)
          Length = 672

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 19/57 (33%), Positives = 36/57 (63%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D    ++F G L  E + E+L R F++Y   +   ++++ +S +S+G+GFV+F DP+
Sbjct: 213 DPNDFRIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPN 269



 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +Y   ++  I+ D+   KS G GF+SF+D
Sbjct: 237 FAKYTSFLKAKIVRDKKSNKSKGYGFVSFKD 267


>SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 27/117 (23%), Positives = 59/117 (50%), Gaps = 2/117 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE+  L +  +    SQE++++ F   G V  C ++++  +G+S G+ FV + +P   N 
Sbjct: 24  DERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANK 83

Query: 257 VLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            ++  NG  +L  +T+      P + +          +++ GLP ++ E ++  +F+
Sbjct: 84  AVREMNGA-RLQNKTLKVSFARPSSTEIKN-----ANLYISGLPKDMKEEEVEALFK 134


>SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33)
          Length = 392

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +FVG + +E S+E L+  FS  G VI   ++ + E+G+ +G+GF  + D       ++N 
Sbjct: 27  VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQETALSAMRNL 86

Query: 269 GPHQLDGRTI 298
             ++L+GR +
Sbjct: 87  NGYELNGRAL 96


>SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 291

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 3/97 (3%)
 Frame = +2

Query: 71  DDDEKG-KLFVGGLSWETSQENLQRYFSRYG-EVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D + +G KL++G L++ + +  +++ F  +G E +D  ++++ ESGRSRGFGFV      
Sbjct: 3   DGENRGRKLYIGNLNFNSDEGEIEQAFEEFGVEKVD--ILRDKESGRSRGFGFVLLQSAD 60

Query: 245 LVNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
            +   ++      + GR I       +T     RGGG
Sbjct: 61  QIAPAIEKMNQSSVGGRNITVALALDKT---ENRGGG 94


>SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 333

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 1/89 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNL 256
           +K  LFV  L ++  +  ++  FS++G V+  V +  + +G+ +G+G+V +  + S    
Sbjct: 169 DKHTLFVSNLPFDAKESEIEELFSKHG-VVKQVRLVTNRAGKPKGYGYVEYEQESSASTA 227

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKR 343
           VL     ++ GRTI     NP T + P R
Sbjct: 228 VLTLDKTEVKGRTISVALSNPPTRRGPPR 256


>SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 371

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 9/108 (8%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYG-EVIDCVVMKN-------SESGRSRGFGFVTFA 235
           +  K++ G L ++ +Q+ L+  F      V D +++K         +  RSRGFGFVTFA
Sbjct: 48  DPNKVYAGNLPFKLTQDELKAVFEAESLTVTDVLIVKEPRNEFYQQQEPRSRGFGFVTFA 107

Query: 236 DPSLVNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
           +P      +++    ++ GRT+   P   R   +   GGGY   + GG
Sbjct: 108 NPEDAQTAVKSLNGKEVQGRTLKIAPSISR--GRDGGGGGYRGGYRGG 153


>SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 514

 Score = 44.8 bits (101), Expect = 5e-05
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 6/122 (4%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++ ++  +F   L+      +L+ +FS+ G+V D  ++ +  S RS+G  ++ F D S V
Sbjct: 141 EEKDQRTVFCMQLARNIRPRDLEEFFSKVGQVSDVRIISDRNSRRSKGIAYIEFTDKSAV 200

Query: 251 NLVLQNGPHQLDGRTI------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
            L +     +L G  I        K       ++ K+  G  ++++G L  N+TE  ++ 
Sbjct: 201 PLAIGLSGQKLLGAPIMVMLTQAEKNRLAAEAERLKQPLGPTRLYVGSLHFNITEAMVKA 260

Query: 413 IF 418
           +F
Sbjct: 261 VF 262



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-Q 265
           +L+VG L +  ++  ++  F  +G V    ++ +SE+ RS+G+GFV F +       + Q
Sbjct: 243 RLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQ 302

Query: 266 NGPHQLDGRTIDPKPCNPR 322
               +L GR +   P   R
Sbjct: 303 MNGFELAGRPLKIGPVTER 321



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/50 (26%), Positives = 23/50 (46%)
 Frame = +3

Query: 360 RCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           R  +   H  + + +    F  +G V  V ++YD    +S G GF+ F +
Sbjct: 243 RLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFRE 292


>SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24)
          Length = 407

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D   D +  +F+G L ++  +E L+  F+  G V    ++++ ++G  +GFG+V F    
Sbjct: 49  DKAHDHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKD 108

Query: 245 LVNLVLQNGPHQLDGRTID--PKPCNPRT 325
            V   L+    +  GR I   P    P+T
Sbjct: 109 AVVFALKMNNAEFKGRKIRVFPSKDKPQT 137


>SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 382

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCV-VMKNSESGRSRGFGFVTFA--DPSL 247
           D    LF+G L  E  ++ L   FS +G ++    +M++S++G S+GF F+ FA  D S 
Sbjct: 97  DVGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASD 156

Query: 248 VNLVLQNGPH 277
             +   NG +
Sbjct: 157 AAIEAMNGQY 166



 Score = 32.7 bits (71), Expect = 0.23
 Identities = 16/61 (26%), Positives = 32/61 (52%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M   P  + ++   ++VGGL  + S+  +   F + G V++  + K+  +   +G+GFV 
Sbjct: 1   MAAGPIAERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVE 60

Query: 230 F 232
           F
Sbjct: 61  F 61


>SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18)
          Length = 268

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/66 (28%), Positives = 38/66 (57%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D D   ++FV G + ET++  L+ +F  YG V +  ++++ + G S+G+ F+TF    + 
Sbjct: 3   DQDISKRIFVKGFNRETTESELRAFFEEYGVVKESKIVRD-KHGVSKGYAFITFESQEVA 61

Query: 251 NLVLQN 268
           + +  N
Sbjct: 62  DGLRDN 67


>SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 718

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L++  L      E L+  FS YG +    VMK+ + G S+GFGFV F+ P      +   
Sbjct: 214 LYIKNLDDPIDDERLREEFSPYGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAVT-- 270

Query: 272 PHQLDGRTIDPKP 310
             +++GR +  KP
Sbjct: 271 --EMNGRILISKP 281



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           ++V     +   E ++   +  G+++   VM + E G+S+GFGFV+F  P
Sbjct: 111 VYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPE-GKSKGFGFVSFETP 159


>SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)
          Length = 145

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 19/83 (22%), Positives = 46/83 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++ ++  +++     +  + +L+  F  YG + D  +++ +++G+S+GFG+VT+ +    
Sbjct: 58  EEHDQRTIYIRDFRPDIRKSSLESVFGPYGAIEDLSIIR-TQTGKSKGFGYVTYENAESA 116

Query: 251 NLVLQNGPHQLDGRTIDPKPCNP 319
              L  G H +DG+ +  +P  P
Sbjct: 117 QRALA-GTHIIDGKWVIAEPKMP 138


>SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1291

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 17/63 (26%), Positives = 37/63 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   K+F+GGL    +++ ++   S +GE+    ++K+S +G S+G+ F  + D  + ++
Sbjct: 670 DSPHKIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITDV 729

Query: 257 VLQ 265
            +Q
Sbjct: 730 AIQ 732


>SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0)
          Length = 298

 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN-G 271
           +VGGL+ E  ++ L   F  +G++ D  +  +  + + RGFGFV F         + N  
Sbjct: 8   YVGGLAEEVDEKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMN 67

Query: 272 PHQLDGRTIDPKPCNPRTLQK 334
             +L GRTI      P  +++
Sbjct: 68  ESELFGRTIRVNLAKPMKIKE 88


>SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18)
          Length = 209

 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +2

Query: 62  PDMD-DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           PD D       LFV  L+  T+ E+L+  FSR+G ++ C V+++ ++G S  + F+ F
Sbjct: 111 PDADIKPPDNVLFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEF 168


>SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)
          Length = 2386

 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 19/47 (40%), Positives = 33/47 (70%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++GGLS + ++  L   F+++G V D V++++ ESG+SR  GFV F
Sbjct: 526 VWIGGLSEDVTENVLLELFNKFGPVKDVVILRD-ESGKSRQSGFVHF 571


>SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1103

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGK-LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           +  P  D  E GK L+V  LS  T   +L+  FS+YG+V+   ++ NS++  ++ FG VT
Sbjct: 337 KATPTKDKKEGGKSLWVANLSSITRAADLKTRFSQYGKVVGAKIVTNSKAPGAQCFGLVT 396

Query: 230 FADPSLVNLVLQN-GPHQLDGRTI 298
                     +Q+    +L GR I
Sbjct: 397 MTTSEEAAKCIQHLHRTELHGRAI 420


>SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)
          Length = 1313

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 4/95 (4%)
 Frame = +2

Query: 89   KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
            KL+V  L+   +++++Q  FS YG V    +  +  +  SRGF +V + DP      L++
Sbjct: 1158 KLYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKALKH 1217

Query: 269  -GPHQLDGRTIDPK---PCNPRTLQKPKRGGGYPK 361
                Q+DG+ I  +   P  PR ++   R    P+
Sbjct: 1218 MDGGQIDGQEIAVQSVLPPRPRDVRPAYRRPSPPR 1252


>SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D    L V  L++ T+ E+L++ F +YG++ D  + ++  +  SRGF FV F
Sbjct: 13  DGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRF 64


>SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28)
          Length = 419

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
 Frame = +2

Query: 62  PDMDDDEKGK--LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           PD  +++  K  L++ GL   T+ ++L R   +YG +I    + + ++   +G+GFV F 
Sbjct: 90  PDTGEEKLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFE 149

Query: 236 DP 241
            P
Sbjct: 150 SP 151



 Score = 30.7 bits (66), Expect = 0.92
 Identities = 13/50 (26%), Positives = 28/50 (56%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           + +   L++  L     +  L+  FS+YG+VI   ++++ ++  S+G GF
Sbjct: 175 EQDPTNLYIQNLPQNCDEAMLENMFSKYGKVISTRILRDKDT-NSKGVGF 223


>SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11)
          Length = 248

 Score = 38.7 bits (86), Expect = 0.003
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           + ++G LS+   ++ L+  F     V+D  V+ + E+GR RGFGFVT
Sbjct: 83  RCYIGNLSYSVDEQALEEKFHDCN-VVDVRVITDRETGRPRGFGFVT 128


>SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39)
          Length = 507

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M  N +  +    +++VG L  +  +++L   F +YG + D V +KN   G    F FV 
Sbjct: 249 MSSNMNRSNSNDCRVYVGNLPQDVREKDLHDIFYKYGHIAD-VDLKN-RRGAGPPFAFVE 306

Query: 230 FADP-SLVNLVLQNGPHQLDGRTI 298
           F DP    + V     H+ DG  I
Sbjct: 307 FEDPRDAEDAVKGRDGHEFDGYRI 330


>SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07)
          Length = 97

 Score = 37.9 bits (84), Expect = 0.006
 Identities = 25/84 (29%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D+D+    ++F+   S   + E+++  F +YG + D  V+K+  +  +RG  +V F   S
Sbjct: 17  DVDNPPFSRVFIV-CSKRHNAEDIRSAFEQYGTIEDVWVVKDKATKENRGVCYVKFVKAS 75

Query: 245 LVNLVLQNGPHQLDGRTI--DPKP 310
              L  +    ++DGR I  DPKP
Sbjct: 76  SAALACE----EMDGRNIGDDPKP 95


>SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 783

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           P+ D      LFVG L    S ++L+  F ++G V+D V +K    G+   + FV FAD
Sbjct: 229 PEEDPKATRTLFVGNLETGISCQDLRLSFEKFGVVLD-VDIKRPARGQGNTYAFVKFAD 286


>SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 1026

 Score = 37.5 bits (83), Expect = 0.008
 Identities = 17/70 (24%), Positives = 36/70 (51%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +F+  LS++++Q+N+   F ++G++  C V+ +  +  S+G  FV +     V   L   
Sbjct: 418 VFIRNLSFDSTQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAAT 477

Query: 272 PHQLDGRTID 301
               +G  +D
Sbjct: 478 DEDSEGLFLD 487



 Score = 34.7 bits (76), Expect = 0.057
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSR--GFGFVTFAD 238
           +K +L +  L++  ++  L+  FS +GEV +  V +     R+R  GFGFV F +
Sbjct: 245 KKSRLIIRNLAFNCTEAILKETFSAFGEVSEASVPQKKVGRRNRKMGFGFVQFTN 299



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 1/90 (1%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSES-GRSRGFGFVTFADPSLVNLV 259
           K  +FV  L +  +    +  F   G +    ++K+ ++  R RGFG+VTFA      L 
Sbjct: 19  KTTIFVRNLPYNITDAEFKSAFEEIGPLKRGFIVKDKDNQNRCRGFGYVTFALEEDA-LK 77

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
            ++    + GR I       +   KP R G
Sbjct: 78  AKDNIKSIKGRPIHLDFSEKKARTKPGREG 107


>SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 828

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 13/57 (22%), Positives = 31/57 (54%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  D+ +   L+V  +  +  +   ++ F  YG +++C ++++  +G  +G GFV +
Sbjct: 125 PGGDNTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLY 181



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 3/87 (3%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  + ++ +QE +   F + G V    +M + +  + +GF FVT A         QN 
Sbjct: 277 LYVYNIGYDANQEGITALFGQCGIVNKVDIMWDWQRQQCKGFCFVTMATQE----EAQNA 332

Query: 272 PHQLDGRTIDPKPCNP---RTLQKPKR 343
              L+G     KP      RTL +  R
Sbjct: 333 IQTLNGFMYTNKPLQSSRIRTLNRRSR 359


>SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07)
          Length = 252

 Score = 36.7 bits (81), Expect = 0.014
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 3/62 (4%)
 Frame = +2

Query: 179 VMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQ-LDGRTIDPKPCNPR--TLQKPKRGG 349
           ++ + E+GR RGFGFVTF     +   +     Q LDGR +      PR  +     +GG
Sbjct: 127 IITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPRGDSGGGGSQGG 186

Query: 350 GY 355
           GY
Sbjct: 187 GY 188


>SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 871

 Score = 36.3 bits (80), Expect = 0.019
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           LFVG L +E ++       S YG +    ++++  +G S+G+GFV +A
Sbjct: 115 LFVGNLPFEFTETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYA 162



 Score = 28.7 bits (61), Expect = 3.7
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +2

Query: 134 LQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           ++  FS+ G V    V  N  +G SRGF FV +A
Sbjct: 222 IKELFSQTGNVTFAQVAINPANGGSRGFAFVDYA 255


>SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42)
          Length = 1531

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           LFVG +   T+  +L+  F RYGEVID  + K  + G +  + FV FA+ S
Sbjct: 251 LFVGNIEKTTTYGDLKEAFERYGEVIDVDIKK--QPG-NNPYAFVQFAELS 298



 Score = 31.5 bits (68), Expect = 0.53
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEV--IDCVVMKNSESGRSRGFGFVTFAD 238
           E   L+VG L     +E++ ++F+RYG V  +  +  +++E GR+    FV F D
Sbjct: 4   ETRHLWVGNLPENIREEDIVKHFTRYGRVESVKILPKRSAEGGRA---SFVDFVD 55



 Score = 30.7 bits (66), Expect = 0.92
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVV 181
           ++VGG++   S++ ++R+F RYG V   V+
Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKVVI 359


>SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69)
          Length = 166

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 182 MKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDP 304
           +K+ +SGRS+ +GFV F D       + N PH ++G+   P
Sbjct: 94  VKDLKSGRSKKYGFVFFKDEEACEKAMGNQPHFIEGQKSGP 134


>SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1208

 Score = 35.1 bits (77), Expect = 0.043
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 155 YGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN-GPHQLDGRTIDPKPCNPRTLQ 331
           YGE+++  ++++ ++G+ +GF F+ + D     L + N    +L GRTI    C+    +
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFNGIKLGGRTIRVDHCS--NYR 59

Query: 332 KPK 340
           +PK
Sbjct: 60  RPK 62


>SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013)
          Length = 665

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 15/58 (25%), Positives = 29/58 (50%)
 Frame = +2

Query: 176 VVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
           ++M +  + R RGFGFVTF   +  +       H ++ + ++ K   P+ +    +GG
Sbjct: 1   MLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKEVMYSLQGG 58


>SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 610

 Score = 34.3 bits (75), Expect = 0.075
 Identities = 20/72 (27%), Positives = 36/72 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F+G +  +  ++ L   F   G + D  +M +  SG ++GF F TF++        QN
Sbjct: 153 QVFIGKVPRDCFEDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNKD----EAQN 208

Query: 269 GPHQLDGRTIDP 304
              +LD + I P
Sbjct: 209 AVKKLDNKEIRP 220



 Score = 30.7 bits (66), Expect = 0.92
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVV--MKNSESGRSRGFGFVTFADPSLVNL 256
           +LFVG +    S++ +   FS+    +D V+  +   + G++RGF F+ +      +L
Sbjct: 234 RLFVGSIPKTKSKQEILEEFSKVTNGLDDVIVYLSADQKGKNRGFAFLEYESHQAASL 291


>SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035)
          Length = 258

 Score = 33.9 bits (74), Expect = 0.099
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +2

Query: 176 VVMKNSESGRSRGFGFVTFAD-PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
           V+M+  +  RSRGFGFVT  +   L ++  +    + +GR +     +  +    +RGGG
Sbjct: 72  VIMEREQPERSRGFGFVTLENQEDLEDVTRKFDGFEYEGRRLKVAEASKDSGGGGRRGGG 131

Query: 353 Y 355
           Y
Sbjct: 132 Y 132


>SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 781

 Score = 33.1 bits (72), Expect = 0.17
 Identities = 14/62 (22%), Positives = 33/62 (53%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTID 301
           + E+L+  F  +G++    ++++ ++  ++G+G+V F   S   + L+N    L     +
Sbjct: 65  NDEDLRSKFESFGDIEYVQIVRDHKTRENKGYGYVKFHKSSTAAMALENCDKSLKAVWAE 124

Query: 302 PK 307
           PK
Sbjct: 125 PK 126



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +LFV  +S   +QE + R F     +  C + +N  +G S+GF +VT+
Sbjct: 204 RLFVI-ISTAVTQEQVVRLFDIIPGMQVCDLKRNYNTGESKGFAYVTY 250


>SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21)
          Length = 304

 Score = 32.7 bits (71), Expect = 0.23
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           E   + V  LS ET + +LQ  F   G +    + K+  + +S+GF F+ F
Sbjct: 179 ETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINF 229


>SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 414

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 6/71 (8%)
 Frame = +2

Query: 155 YGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQNGPH-----QLDGRTIDPKPCN 316
           Y EVI   V+ + E+ RSR FG+VTF D     + + Q G       ++ GR ++ +   
Sbjct: 2   YAEVI---VVYDRETRRSRNFGYVTFRDEQDAADAMKQMGGESGKGKEIFGRALNIEYAQ 58

Query: 317 PRTLQKPKRGG 349
            +    P+RGG
Sbjct: 59  EKESSAPRRGG 69



 Score = 29.1 bits (62), Expect = 2.8
 Identities = 9/24 (37%), Positives = 18/24 (75%)
 Frame = +3

Query: 441 EVVIMYDQXKKKSXGXGFLSFEDE 512
           EV+++YD+  ++S   G+++F DE
Sbjct: 4   EVIVVYDRETRRSRNFGYVTFRDE 27


>SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 24/89 (26%), Positives = 37/89 (41%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  K+++G L    S+  ++  F  YG + D  V +N       GF F  F D       
Sbjct: 30  EMTKVYIGSLGDNASKREIENEFGYYGPLKDVWVARNPP-----GFAFCIFDD----RRD 80

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
            ++   +LDGR I  +       + P RG
Sbjct: 81  AEDAVRELDGRYICGQRVRVELAKGPSRG 109


>SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 31.5 bits (68), Expect = 0.53
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           +LFVG LS ET   +L+  F  YG+++ C +           +GF+ + DP
Sbjct: 7   QLFVGRLSKETKLRDLENVFYLYGKLLRCDL--------KTAYGFIEYEDP 49


>SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 435

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 13/114 (11%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYF----SRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           + +VG LS + ++E+L  +F    + Y      V +   +SG+S GFGFV        +L
Sbjct: 6   RFYVGNLSVKATREDLSHHFGLDATPYLRSSCWVELAVEKSGKSLGFGFVNVPKHLADHL 65

Query: 257 VLQNGPHQLDGR-TIDP---KPCNPRTLQK---PKRGGGYPKV--FLGGLPSNV 391
           +  N     D R TI+P   K   P  +     P   GG       +GG PS++
Sbjct: 66  MHLNQTKLFDKRITIEPARGKDTPPSMITPGVLPSAPGGVASYTGSMGGRPSSI 119


>SB_3721| Best HMM Match : RRM_1 (HMM E-Value=3.1)
          Length = 51

 Score = 31.1 bits (67), Expect = 0.70
 Identities = 13/39 (33%), Positives = 22/39 (56%)
 Frame = +2

Query: 197 SGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPC 313
           +GRS+G+ +V F + S V   L     +++GR +   PC
Sbjct: 2   AGRSKGYAYVEFNNESTVQAALAMDREKMEGRPMFISPC 40


>SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017)
          Length = 255

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSR 211
           D    KLFVG +     +++L+  F  YG++ +  ++K+  +G+ +
Sbjct: 166 DSNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHK 211


>SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13)
          Length = 337

 Score = 30.7 bits (66), Expect = 0.92
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = +2

Query: 62  PDMDDDEK--GKLFVGGLSWETSQENLQRYFSRYGEV 166
           P  +D E+    +FVG L     ++ L++YFS+YGEV
Sbjct: 11  PTPEDPERLDRTVFVGNLPLTLKKKALKKYFSKYGEV 47


>SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35)
          Length = 1118

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 15/50 (30%), Positives = 32/50 (64%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           ++++G L + T++++++R+F  YG + D + +KN+       +GFV F D
Sbjct: 4   RVYLGRLPYGTTEDDVRRFFRSYGRLRD-INLKNN-------YGFVEFED 45



 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIFRT 424
           +V+LG LP   TE D+R  FR+
Sbjct: 4   RVYLGRLPYGTTEDDVRRFFRS 25


>SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 12/44 (27%), Positives = 25/44 (56%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           K K+FVG + ++     L+ +F  +G+V+   ++ +    RS+G
Sbjct: 78  KCKVFVGNIGFKVRARELKDFFGYFGDVVYAQIIMDRVKKRSKG 121


>SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23)
          Length = 44

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 10/38 (26%), Positives = 24/38 (63%)
 Frame = +2

Query: 155 YGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           YGE+++  ++++ ++G+ +GF F+ + D     L + N
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDN 39


>SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 381

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKG-KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           G R  P    +E G ++F+G +  +  ++ L     + GE+ +  +  +  +G ++GF F
Sbjct: 139 GERGFPTTWTEESGTEVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAF 198

Query: 224 VTFAD 238
            TF +
Sbjct: 199 CTFTE 203


>SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 949

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 16/110 (14%)
 Frame = +2

Query: 53  RMNPDMDDDEKGK------------LFVGGLSWETSQEN-LQRYFSRYGEVIDCVVMKNS 193
           R++PD DD E  +            + + GL  E S+++ LQ  ++      D  +++N 
Sbjct: 308 RLSPDRDDREHRRQGPRDPGPPTSVIMLHGLRDEISEDDVLQELYAAEVAFRDVRIVRN- 366

Query: 194 ESGRSRGFGFVTFADPSLVNL---VLQNGPHQLDGRTIDPKPCNPRTLQK 334
           + G +RGFGFV F  P         L+ GP ++ G  I  +   P+  Q+
Sbjct: 367 KIGYTRGFGFVEFDTPEAAKEWMDYLKGGPLKVLGYNIGVEYSRPKEGQE 416


>SB_4929| Best HMM Match : C2 (HMM E-Value=2.4e-33)
          Length = 567

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 3/76 (3%)
 Frame = +1

Query: 184 EE*RVRTFE-GLWFRDIC*--SFTGQPRATEWTSST*WQDHRP*AVQSSHSSKTETWRWI 354
           EE R R  E  +W  DI     F G  R    TS+  W D      Q  H+  T T  WI
Sbjct: 492 EELRQRVLEISIWDHDIASRDEFLGGLRLGLGTSANEWDDSSKDEAQIWHTMLTRTNVWI 551

Query: 355 P*GVPWRAAIERYRNR 402
              VP R  ++ ++++
Sbjct: 552 QVVVPLRPNMDAHKHQ 567


>SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 721

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 13/47 (27%), Positives = 25/47 (53%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           LFV  +  E  ++++   FS YGE+ +  V  +  +G  +G+  V +
Sbjct: 295 LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEY 341


>SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 593

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 1/81 (1%)
 Frame = +3

Query: 279 NLMAG-PSTLSRAILALFKNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIM 455
           N+  G PS + +A   + +    A    R  +A  H  L +      F  +GKV+   + 
Sbjct: 172 NIKVGRPSNVPQAAPLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVFEAFGKVVHCSLS 231

Query: 456 YDQXKKKSXGXGFLSFEDEXS 518
            +    K  G GF+ +E++ S
Sbjct: 232 KEPMTGKHKGYGFIEYENQQS 252


>SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1148

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = +2

Query: 302 PKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           P P  P   QK K  G    VF+GGLP ++ E  +  IF
Sbjct: 334 PPPDMPMQKQKEKPEG-CRTVFIGGLPESINEHIINEIF 371


>SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13)
          Length = 633

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -3

Query: 405 RSVSVTFDGSPPRNTLGYPPPRFG 334
           R+++VT   SP    LG+PPP+ G
Sbjct: 237 RNIAVTLAISPTNGMLGHPPPKQG 260


>SB_53221| Best HMM Match : zf-CCHC (HMM E-Value=0.061)
          Length = 410

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVI 169
           ++  + +L V GL WE   E+L    S YGE I
Sbjct: 185 EEVSRARLQVHGLPWEVPDEDLVALLSPYGEGI 217


>SB_38068| Best HMM Match : UreE_N (HMM E-Value=0.46)
          Length = 413

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 5/44 (11%)
 Frame = +1

Query: 361 GVPWRAAIERYRNRSQG-----YFSDAMGRSWRWSLCMIXRRKS 477
           G+ W AA++RY N +QG     Y+S    R  R+ L  I +  S
Sbjct: 163 GIEWPAAMKRYENSAQGKHDGFYWSKREQRYQRFYLLAIQKENS 206


>SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05)
          Length = 410

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVI 169
           + +L V GL WE   E+L    S YGE I
Sbjct: 81  RARLQVHGLPWEVPDEDLVALLSPYGEGI 109


>SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7)
          Length = 493

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 299 DPKPCNPRTLQKPKRGGGYPK 361
           +PKP NP T  KP   G +PK
Sbjct: 281 NPKPTNPGTHPKPMNPGTHPK 301


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,069,603
Number of Sequences: 59808
Number of extensions: 386521
Number of successful extensions: 1246
Number of sequences better than 10.0: 71
Number of HSP's better than 10.0 without gapping: 1025
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1226
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1422302661
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -