SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_44543| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.15 
SB_56178| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.4  
SB_45145| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.4  
SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41)          27   5.6  
SB_18135| Best HMM Match : Cytochrom_B561 (HMM E-Value=0.5)            26   9.8  
SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28)              26   9.8  
SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05)                26   9.8  
SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0)                 26   9.8  

>SB_44543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 281

 Score = 32.3 bits (70), Expect = 0.15
 Identities = 15/45 (33%), Positives = 19/45 (42%)
 Frame = +3

Query: 261 KYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           +YCMP +G+                I       GV K+R TGGEP
Sbjct: 5   QYCMPEDGIKLTPSNEVLSSEEIILIARMFVKQGVTKIRLTGGEP 49


>SB_56178| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 632

 Score = 29.1 bits (62), Expect = 1.4
 Identities = 11/27 (40%), Positives = 12/27 (44%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSCG 333
           C     C  K CPC +A R C    CG
Sbjct: 416 CRCKAQCNTKQCPCFLAVRECDPDLCG 442


>SB_45145| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 29.1 bits (62), Expect = 1.4
 Identities = 18/44 (40%), Positives = 20/44 (45%)
 Frame = +1

Query: 202 MVVDTTTCEYLSLSDATCDASTACRRKACPCPVAARCCQWKSCG 333
           MVV  TT     L   T  A+T CR + C    A RCC W   G
Sbjct: 1   MVVGETTTVVGELFQLTNLATTQCRDR-CKKRCALRCCVWNLHG 43


>SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41)
          Length = 336

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +3

Query: 147 RLYSDDSRVEAAASLSDLHGR 209
           RL +DD+ VE AA  +D+H R
Sbjct: 240 RLEADDAAVEEAAQAADIHNR 260


>SB_18135| Best HMM Match : Cytochrom_B561 (HMM E-Value=0.5)
          Length = 1595

 Score = 26.2 bits (55), Expect = 9.8
 Identities = 17/61 (27%), Positives = 28/61 (45%)
 Frame = -1

Query: 324  LPLTAASCDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDDHVGRLMRPPPPHGCHHCTIY 145
            + +T ++       LP  C   I   IA   +FA   +  H+ +++    PH C H +IY
Sbjct: 1174 IAVTLSTAQLLSRYLPHNCCHAIYRTIAV-TLFAAQLLSRHLPQVLSRYLPHNCCH-SIY 1231

Query: 144  R 142
            R
Sbjct: 1232 R 1232


>SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28)
          Length = 246

 Score = 26.2 bits (55), Expect = 9.8
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = -1

Query: 225 AGSCVDDHVGRLMRPPPPHGCHH 157
           AG  +     RL+ PPPP   HH
Sbjct: 188 AGCAIGSSGPRLLPPPPPSAYHH 210


>SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05)
          Length = 346

 Score = 26.2 bits (55), Expect = 9.8
 Identities = 9/15 (60%), Positives = 9/15 (60%)
 Frame = -1

Query: 189 MRPPPPHGCHHCTIY 145
           M PP PHGC  C  Y
Sbjct: 124 MGPPGPHGCASCVDY 138


>SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0)
          Length = 1706

 Score = 26.2 bits (55), Expect = 9.8
 Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%)
 Frame = -1

Query: 303 CDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDDHVGRL-MRPPPPHGCHHCTIY 145
           C  +G+ + P C      C  +  +    C     G   +    PHGC HC  Y
Sbjct: 789 CSMSGS-ITPICDNADGKCQCKANVEGAKCDACKYGTFHLDSGNPHGCQHCFGY 841


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,234,442
Number of Sequences: 59808
Number of extensions: 257411
Number of successful extensions: 634
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 586
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 634
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 703143849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -