BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov2p23 (399 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.15 SB_56178| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_45145| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) 27 5.6 SB_18135| Best HMM Match : Cytochrom_B561 (HMM E-Value=0.5) 26 9.8 SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28) 26 9.8 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 26 9.8 SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) 26 9.8 >SB_44543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 32.3 bits (70), Expect = 0.15 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 261 KYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395 +YCMP +G+ I GV K+R TGGEP Sbjct: 5 QYCMPEDGIKLTPSNEVLSSEEIILIARMFVKQGVTKIRLTGGEP 49 >SB_56178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 29.1 bits (62), Expect = 1.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 253 CDASTACRRKACPCPVAARCCQWKSCG 333 C C K CPC +A R C CG Sbjct: 416 CRCKAQCNTKQCPCFLAVRECDPDLCG 442 >SB_45145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.1 bits (62), Expect = 1.4 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +1 Query: 202 MVVDTTTCEYLSLSDATCDASTACRRKACPCPVAARCCQWKSCG 333 MVV TT L T A+T CR + C A RCC W G Sbjct: 1 MVVGETTTVVGELFQLTNLATTQCRDR-CKKRCALRCCVWNLHG 43 >SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) Length = 336 Score = 27.1 bits (57), Expect = 5.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 147 RLYSDDSRVEAAASLSDLHGR 209 RL +DD+ VE AA +D+H R Sbjct: 240 RLEADDAAVEEAAQAADIHNR 260 >SB_18135| Best HMM Match : Cytochrom_B561 (HMM E-Value=0.5) Length = 1595 Score = 26.2 bits (55), Expect = 9.8 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = -1 Query: 324 LPLTAASCDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDDHVGRLMRPPPPHGCHHCTIY 145 + +T ++ LP C I IA +FA + H+ +++ PH C H +IY Sbjct: 1174 IAVTLSTAQLLSRYLPHNCCHAIYRTIAV-TLFAAQLLSRHLPQVLSRYLPHNCCH-SIY 1231 Query: 144 R 142 R Sbjct: 1232 R 1232 >SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28) Length = 246 Score = 26.2 bits (55), Expect = 9.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 225 AGSCVDDHVGRLMRPPPPHGCHH 157 AG + RL+ PPPP HH Sbjct: 188 AGCAIGSSGPRLLPPPPPSAYHH 210 >SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) Length = 346 Score = 26.2 bits (55), Expect = 9.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 189 MRPPPPHGCHHCTIY 145 M PP PHGC C Y Sbjct: 124 MGPPGPHGCASCVDY 138 >SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1706 Score = 26.2 bits (55), Expect = 9.8 Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -1 Query: 303 CDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDDHVGRL-MRPPPPHGCHHCTIY 145 C +G+ + P C C + + C G + PHGC HC Y Sbjct: 789 CSMSGS-ITPICDNADGKCQCKANVEGAKCDACKYGTFHLDSGNPHGCQHCFGY 841 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,234,442 Number of Sequences: 59808 Number of extensions: 257411 Number of successful extensions: 634 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -