BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120104.Seq (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_6824| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 29 4.2 SB_29724| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-05) 28 7.3 SB_34115| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 7.3 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_11940| Best HMM Match : TspO_MBR (HMM E-Value=6.8) 28 9.6 SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_39148| Best HMM Match : OEP (HMM E-Value=0.33) 28 9.6 SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = -3 Query: 502 KFTKASVSNSRLSILTIDGLSTEHNSTPSFSVN-KMGSPGMLVSLVSVTTNSILLVKLV 329 +F + +NS LT++ L + + T + S +G ++VS+ SVTTNS++LV ++ Sbjct: 746 RFERFEHNNSLEIKLTVNILQNQGSRTMTSSYYLAIGILSIIVSITSVTTNSLILVVII 804 >SB_6824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1152 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = -3 Query: 553 LRGAKRLGYPHVAVIFSKFTKASVSNSRLSILTIDGLSTEHNSTPSFSVNKMGSPGMLVS 374 ++G RLGY V+ ++T+ + R ++T+ L T HN +M + G L + Sbjct: 932 VKGCSRLGYLDVSWNQLQYTREELGMMRKHLITLTYLDTRHNPWQKTETLRMRALGRLKN 991 Query: 373 L 371 L Sbjct: 992 L 992 >SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 22 KCIKMKRVKCNKVR-TVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYM 198 K + KR K++ T E+V +K +K + L + +LK L E Y+ LK K L KY+ Sbjct: 68 KSAEAKRESKKKIKETERELV---QKGKKPFYLRKSELKKLELAEKYKELKSKGKLQKYL 124 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 29.1 bits (62), Expect = 4.2 Identities = 21/83 (25%), Positives = 39/83 (46%) Frame = +1 Query: 4 KANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLA 183 +A + +KC ++ V+ K V+ I DEK+ + + E L +L+S + +++ Sbjct: 979 QAQLEEKCTELGNVESEKQYLVSMINERDEKLYEIQDSFEAQLLDLTSSRDND---VEIL 1035 Query: 184 LSKYMAMLSTLEMTQPLLEIFRN 252 S+ +M L Q E RN Sbjct: 1036 RSEQESMHQVLTERQQECETLRN 1058 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 29.1 bits (62), Expect = 4.2 Identities = 21/83 (25%), Positives = 39/83 (46%) Frame = +1 Query: 4 KANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLA 183 +A + +KC ++ V+ K V+ I DEK+ + + E L +L+S + +++ Sbjct: 927 QAQLEEKCTELGNVESEKQYLVSMINERDEKLYEIQDSFEAQLLDLTSSRDND---VEIL 983 Query: 184 LSKYMAMLSTLEMTQPLLEIFRN 252 S+ +M L Q E RN Sbjct: 984 RSEQESMHQVLTERQQECETLRN 1006 >SB_29724| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-05) Length = 435 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 184 LSKYMAMLSTLEMTQPLLEIFRNKQTLGKLPPWCLAH*LLYTIDSI 321 +S ML+ L T PL+ + ++TLG++P +C L T+ + Sbjct: 87 ISASCLMLTLLSYTVPLISMNATQKTLGEVPLFCYWSALFETLGCV 132 >SB_34115| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1572 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 363 TETNDTSIPGEPILFTENEGVLLCSVDRPSIVKMLS 470 +E D SI P + N G L+C VDR SI ++ S Sbjct: 37 SELADVSIEPTPHILVGNGG-LMCGVDRESITRVFS 71 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 526 DSQDVWRL*AQKHDAQHDYESNKQPDYDMDLSDFSI 633 D D W A+K D DY +NK D D +LSD + Sbjct: 977 DDPDFWEKWAKKADLDVDYLNNK--DGDFELSDIEM 1010 >SB_11940| Best HMM Match : TspO_MBR (HMM E-Value=6.8) Length = 229 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 574 HDYESNKQPDY-DMDLSDFSITAVEATQYLTLLLIVEHAYLHYYI 705 +DY++ PD D DLS+ + + T LT++L L YYI Sbjct: 143 YDYKALVPPDVLDHDLSNRHLNVMSGTVALTVVLFSGSVGLFYYI 187 >SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -1 Query: 609 IVIWLFI*LVIMLRVVFLRLEAPNVLAIRTLQL 511 IV+WL +I LR++ LRL A ++ +R + L Sbjct: 794 IVLWLIALQLIALRLIVLRLIALRLITLRLIAL 826 >SB_39148| Best HMM Match : OEP (HMM E-Value=0.33) Length = 208 Score = 27.9 bits (59), Expect = 9.6 Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +1 Query: 31 KMKRVKCNKVRTVTEIVNSDEKIQKT-YELAEFDLKNLSSLESYETLKIKLALSKYMAML 207 K+ + K + ++ + K+ K Y+LA+ K + + K KLA +KY Sbjct: 53 KLAKAKYKLAKAKYKLAKAKYKLAKAKYKLAKAKYKLVKATYKLANAKYKLAKAKYKPAK 112 Query: 208 STLEMTQPLLEIFRNKQTLGK 270 +T ++ + ++ K L K Sbjct: 113 ATYKLAKAKYKLANAKNKLAK 133 >SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -2 Query: 275 GNLPSVCLFLNISNSGWVISRVLSIAMYLLSANLI 171 G++ +VCLFLN++N I R+++ + L +A + Sbjct: 170 GSMENVCLFLNLANDP-TIERIITPRLALTTAEFL 203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,133,593 Number of Sequences: 59808 Number of extensions: 454795 Number of successful extensions: 1136 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1116 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -