SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42686| Best HMM Match : Pkinase (HMM E-Value=0)                     50   2e-06
SB_15979| Best HMM Match : Pkinase (HMM E-Value=0)                     46   5e-05
SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   8e-05
SB_33125| Best HMM Match : Pkinase (HMM E-Value=0)                     43   3e-04
SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31)               42   4e-04
SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26)               42   8e-04
SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10)               41   0.001
SB_3739| Best HMM Match : Pkinase (HMM E-Value=0)                      40   0.002
SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07)               40   0.002
SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_31780| Best HMM Match : Pkinase (HMM E-Value=0)                     40   0.003
SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23)                40   0.003
SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09)               39   0.004
SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12)           38   0.007
SB_33829| Best HMM Match : Pkinase (HMM E-Value=0)                     38   0.010
SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.013
SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22)               38   0.013
SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17)               37   0.022
SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.022
SB_12255| Best HMM Match : Pkinase (HMM E-Value=0)                     37   0.022
SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0)                36   0.029
SB_59029| Best HMM Match : Pkinase (HMM E-Value=0)                     36   0.039
SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.051
SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.051
SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07)               36   0.051
SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.051
SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10)                 35   0.068
SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24)               35   0.068
SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39)               35   0.090
SB_22253| Best HMM Match : Pkinase (HMM E-Value=0)                     35   0.090
SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.16 
SB_11460| Best HMM Match : Pkinase (HMM E-Value=0)                     34   0.16 
SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27)               33   0.27 
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              33   0.36 
SB_17930| Best HMM Match : Pkinase (HMM E-Value=0)                     33   0.36 
SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37)                33   0.36 
SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.48 
SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37)                   32   0.63 
SB_26967| Best HMM Match : Pkinase (HMM E-Value=0)                     32   0.63 
SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20)               32   0.63 
SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14)               31   1.1  
SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.1  
SB_28695| Best HMM Match : Ras (HMM E-Value=0)                         31   1.1  
SB_41851| Best HMM Match : Pkinase (HMM E-Value=0)                     31   1.5  
SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05)               30   1.9  
SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   2.6  
SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26)               30   2.6  
SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.4  
SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 29   3.4  
SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.4  
SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.4  
SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.5  
SB_35776| Best HMM Match : Pkinase (HMM E-Value=0)                     29   4.5  
SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.5  
SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10)               29   5.9  
SB_46109| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.9  
SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.9  
SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.9  
SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07)               29   5.9  
SB_4038| Best HMM Match : v110 (HMM E-Value=5.5)                       29   5.9  
SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.8  
SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.8  
SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.8  
SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19)                28   7.8  

>SB_42686| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 759

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/80 (27%), Positives = 42/80 (52%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           DEI + +    HPN ++++ ++       +VM+ I   DLF+ +    + +  +  +  R
Sbjct: 492 DEIAIMRRCR-HPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFR 550

Query: 61  QLCEALNDLHKHNFIHNDIK 2
            +C+AL  LHK   +H D+K
Sbjct: 551 DMCKALAYLHKRKIVHRDLK 570


>SB_15979| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 367

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNI 68
           ++E KV   ++ HPN I  Y +       +I M+Y D   L + L +++ ++  + + N+
Sbjct: 73  MNEAKVLSKLSLHPNIISYYDSFEVEGTLMIEMEYADGGTLAQYLTKLEKDMEEKDILNM 132

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            +Q+  AL  +H +N +H D+K
Sbjct: 133 FQQMLSALKYIHNNNILHRDLK 154


>SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 428

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I++Y     ++   IVM+Y    +LF  +  +G+L  ++   +  Q+  A+  +H 
Sbjct: 117 HPNIIRLYEVIETLSKLHIVMEYACGGELFAKISNEGKLPERIAKKLYGQVLSAVEHMHD 176

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 177 NDIIHRDLK 185


>SB_33125| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 937

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 21/79 (26%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + + DHPN +K+Y          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 130 EVRIMKFL-DHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 188

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+ + IH D+K
Sbjct: 189 IVSAVQYCHQKHVIHRDLK 207


>SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31)
          Length = 801

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 7/102 (6%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYF----NHGFINNQVIVMDYIDCP--D 125
           ++V  E N+  + NV E++V++ M  HPN +  Y     N   + N  I M+  D    D
Sbjct: 567 ELVLKETNY--SLNVQELEVYKRMGQHPNIVDHYCITLGNLKGLLNMNIFMEQCDMSLRD 624

Query: 124 LFETLQIKG-ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             + ++ +G +LS         Q+C A++ +H    IH DIK
Sbjct: 625 YLDYMKAEGSQLSVNEAMFYWTQVCMAVDHIHTSGIIHKDIK 666


>SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26)
          Length = 239

 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -3

Query: 235 IKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQ 59
           I + +++ D PN +    + G      +V +Y+D  DL   L+     L+   + + IRQ
Sbjct: 38  INLKEIVTDKPNALDFRKDKGAF---YLVFEYMD-HDLMGLLESGLVHLTEDHIKSFIRQ 93

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L + LN  HK NF+H DIK
Sbjct: 94  LLDGLNYCHKKNFLHRDIK 112


>SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 920

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +L+  HP+ +K+Y      N   +V DY +  ++F+ L   G L  +       Q
Sbjct: 204 EVQIMKLLQ-HPHIVKLYQVMETKNMLYLVTDYANNGEMFDYLAHHGRLPEKEARKKFVQ 262

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  HK + +H D+K
Sbjct: 263 ILSAVDYCHKRHVVHRDLK 281


>SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10)
          Length = 460

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL----VSN 71
           E+  H ++  HP+ ++ Y      N+ +I  +Y D   L + +Q   +L  +L    +  
Sbjct: 183 EVYAHAVLGTHPHVVRYYSAWAEDNHMLIQNEYCDGGSLADRIQSNNKLGERLSEADLKM 242

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           ++ QL + L  +H  + +H DIK
Sbjct: 243 LLLQLAQGLKYIHSLHLVHMDIK 265


>SB_3739| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 490

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y +H   +   +VM++++   L + +     LS + V+ + R + +AL  LH 
Sbjct: 272 HPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVT-HTNLSEEQVACVCRAVLKALTFLHS 330

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 331 QGVIHRDIK 339


>SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 360

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCEALNDL 35
           HPN +K+Y          +V +YI   +L   ++   E  LS      I+RQ+  AL+ L
Sbjct: 73  HPNIVKLYETLKQRGVYCLVTEYIPGGELLGLIRSHQESRLSETQARPIVRQIVSALHHL 132

Query: 34  HKHNFIHNDIK 2
           H+   +H D+K
Sbjct: 133 HEQGIVHRDLK 143


>SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07)
          Length = 268

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 8/77 (10%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQ-----VIVMDY-IDCPDLFETLQIK--GELSHQLVSNIIRQLC 53
           H N I++  ++  ++N+     VIVM+    C DLF  LQI+  G +  ++   I R + 
Sbjct: 110 HVNIIELLAHYTMLDNEQTSRHVIVMERPAHCLDLFSFLQIQPQGRVKEKVARKIFRDVM 169

Query: 52  EALNDLHKHNFIHNDIK 2
             ++ L K   +HNDIK
Sbjct: 170 RGVDYLDKRGILHNDIK 186


>SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1184

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 21/70 (30%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +K+Y++     N   VMDY+   DL   L   G          I +L  A++ +H
Sbjct: 712 DNEWVVKLYYSFQDQENLYFVMDYVPGGDLMSLLIKFGIFPEDYAKFYIAELVLAIDSVH 771

Query: 31  KHNFIHNDIK 2
           +  F+H DIK
Sbjct: 772 RMGFVHRDIK 781


>SB_31780| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 964

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSN 71
           ++E+KV  +   HPN I+ Y +       +IVM+Y     +++ LQ +G   +    +  
Sbjct: 49  LNEVKVLSMFQ-HPNIIRYYDSFVQEKALMIVMEYAQGGTIYDYLQQRGGKLMDEDEILR 107

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           +  Q+  AL  +HK   +H D+K
Sbjct: 108 LFVQILLALRHVHKGQILHRDLK 130


>SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23)
          Length = 560

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 24/84 (28%), Positives = 38/84 (45%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           NF   EI   +L+  H N +K+Y         +I M+Y+D   +   L   G      V 
Sbjct: 382 NFEECEIANWRLIQGHENVVKLYGAVQTEQKIIIFMEYMDGGSVEMFLSNNGSADEDSVK 441

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
            +++ + EAL  LH    +H D+K
Sbjct: 442 CVMQVILEALCWLHSKGVVHLDLK 465


>SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09)
          Length = 239

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 8/77 (10%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQ-----VIVMDY-IDCPDLFETLQIK--GELSHQLVSNIIRQLC 53
           H N I++  ++  ++N+     VIVM+    C DLF  L+I+  G +  ++   I R + 
Sbjct: 18  HVNIIELLAHYTMLDNEQTSRHVIVMERPAQCLDLFSFLEIQPQGRVKEKVARKIFRDVM 77

Query: 52  EALNDLHKHNFIHNDIK 2
             ++ L K   +HNDIK
Sbjct: 78  RGVDYLDKRGILHNDIK 94


>SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12)
          Length = 640

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +HPN I+            +VM+Y     LFE L+   E++ +L+     Q+ + ++ LH
Sbjct: 155 NHPNIIRFKGVCNQAPVYCVVMEYCPYGQLFEVLRDGREITPELLVGWTTQIADGMHYLH 214

Query: 31  KHNFIHNDIK 2
            +  IH D+K
Sbjct: 215 GNKIIHRDLK 224


>SB_33829| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 290

 Score = 37.9 bits (84), Expect = 0.010
 Identities = 23/91 (25%), Positives = 42/91 (46%)
 Frame = -3

Query: 274 AENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE 95
           A +++   F   EI+V + +N H N + ++      +   I++D  D  DL E ++  G 
Sbjct: 28  APDDYLTKFLPREIQVMKHLN-HSNVVSLHEAIETSSRIYIILDLADNGDLLEYIRSNGA 86

Query: 94  LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +          QL +A+  LH    +H D+K
Sbjct: 87  IPENEARLFYHQLVDAVEYLHNKGVVHRDLK 117


>SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 366

 Score = 37.5 bits (83), Expect = 0.013
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +Y +        ++M+Y+    LF+ +  +   S +    + RQL  AL  LH 
Sbjct: 85  HENIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHS 144

Query: 28  HNFIHNDIK 2
              +H DIK
Sbjct: 145 RRIVHRDIK 153


>SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22)
          Length = 331

 Score = 37.5 bits (83), Expect = 0.013
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 5/75 (6%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFIN--NQVIVMDYIDCPDLFETLQIKGE---LSHQLVSNIIRQLCEA 47
           DH N +KI+ +   +   N++IVM+      LF  L+       LS Q    +IR +   
Sbjct: 65  DHENIVKIFASETELRSQNEIIVMELCSGGSLFTMLEHPSNAYGLSEQDCIAVIRDVVAG 124

Query: 46  LNDLHKHNFIHNDIK 2
           +  LH +  +H D+K
Sbjct: 125 MKHLHDNGIVHRDLK 139


>SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17)
          Length = 181

 Score = 36.7 bits (81), Expect = 0.022
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI +   M+ H   + +   +    N V++M++I   +LFE +  +  L+ +  +  + Q
Sbjct: 46  EIDIMSRMH-HKRLVGLLDAYDANRNIVMIMEFISGGELFERVVDEDCLTEKEAAYYMHQ 104

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L + +  +HK N +H D+K
Sbjct: 105 LLQGIEHVHKKNVLHLDLK 123


>SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 698

 Score = 36.7 bits (81), Expect = 0.022
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +   DLFE +    + +    S+++R L  AL+ LH ++ +H DIK
Sbjct: 93  LVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIK 143


>SB_12255| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 476

 Score = 36.7 bits (81), Expect = 0.022
 Identities = 17/69 (24%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ N        +V D +   +LFE +  +   S    S+ I+Q+  ++   H+
Sbjct: 73  HPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHE 132

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 133 NGIVHRDLK 141


>SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0)
          Length = 1663

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 20/79 (25%), Positives = 38/79 (48%)
 Frame = -3

Query: 238  EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
            E+ V +++  HPN       +    N +IV + +    LF+ L +   L+ ++    + Q
Sbjct: 1137 EVTVLRMLK-HPNLCIFLDAYDTPKNYIIVTELLAGGRLFDYLVVMDALTEKVAIGYMHQ 1195

Query: 58   LCEALNDLHKHNFIHNDIK 2
            + E +  LH  N +H D+K
Sbjct: 1196 VVEGVQHLHDLNIVHLDLK 1214


>SB_59029| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 1023

 Score = 35.9 bits (79), Expect = 0.039
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFIN--NQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           EI++H+ +  H     + F+  F +  N  I+++      L + L+ +G+L+   V   +
Sbjct: 481 EIELHRTLRHH---YVVGFHGSFQDEMNFYILLELCSRKSLVQMLKTRGKLTEPEVRFFM 537

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q  EA + LH+   IH DIK
Sbjct: 538 QQAIEACSYLHEQRVIHRDIK 558


>SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 468

 Score = 35.5 bits (78), Expect = 0.051
 Identities = 12/52 (23%), Positives = 31/52 (59%)
 Frame = -3

Query: 157 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +++M+++   +LFE +     L+ + V   +RQ+ + +  +H+ + +H D+K
Sbjct: 124 IVIMEFVSGGELFEKICNDDNLTEKEVIRYMRQILQGVEHMHRKSIVHLDLK 175


>SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1287

 Score = 35.5 bits (78), Expect = 0.051
 Identities = 20/83 (24%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL-SHQLVSN 71
           N+ E+K  + ++ H N +K+       ++   V +Y+   +L++ ++ + +L    ++ N
Sbjct: 13  NLREVKSLRKLS-HTNIVKLKEVIRENDHLYFVFEYMK-ENLYQMMKNRDKLLPESVIRN 70

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           +I Q+ + L  +HKH + H D+K
Sbjct: 71  VIYQILQGLAFIHKHGYFHRDMK 93


>SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07)
          Length = 216

 Score = 35.5 bits (78), Expect = 0.051
 Identities = 16/52 (30%), Positives = 30/52 (57%)
 Frame = -3

Query: 157 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           VI+MD ++  +  E L  K   + +  + ++RQ  +AL  LH +N +H D++
Sbjct: 116 VIMMDIVEGKNCLEFLGDKPRANEEDAAFVMRQTLDALKYLHSNNIVHLDVR 167


>SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 666

 Score = 35.5 bits (78), Expect = 0.051
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 9/86 (10%)
 Frame = -3

Query: 232 KVHQLMN-DHPNFIKIYFNHGFINNQ-----VIVMDY-IDCPDLFETLQI--KGELSHQL 80
           +VH L    H N I++  ++  ++N+     VIVM+    C DLF  L+I  +G +  + 
Sbjct: 459 EVHYLRKCHHVNIIELLAHYIMLDNEQTSRHVIVMERPAHCLDLFSFLEIQPRGRVKEKG 518

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
              I R +   +  L +   +HNDIK
Sbjct: 519 ARKIFRDVMRGVKYLDQRGILHNDIK 544


>SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10)
          Length = 322

 Score = 35.1 bits (77), Expect = 0.068
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           H N +++ F + + + +V ++++Y    +L++ L    +   +  +  IRQL +AL   H
Sbjct: 86  HNNILRL-FGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCH 144

Query: 31  KHNFIHNDIK 2
               IH DIK
Sbjct: 145 SKKVIHRDIK 154


>SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24)
          Length = 235

 Score = 35.1 bits (77), Expect = 0.068
 Identities = 15/48 (31%), Positives = 27/48 (56%)
 Frame = -3

Query: 145 DYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           D +   +LF+ +  KG  + Q  S +++Q+ EA + LH    +H D+K
Sbjct: 89  DSVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLK 136


>SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39)
          Length = 1486

 Score = 34.7 bits (76), Expect = 0.090
 Identities = 21/79 (26%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ Q++  HP+ I +       N   +V +     DL + +  +  L    V   IRQ
Sbjct: 230 EARILQMVR-HPHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQ 288

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH+   IH D+K
Sbjct: 289 IISAVQYLHQGGIIHRDLK 307


>SB_22253| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 870

 Score = 34.7 bits (76), Expect = 0.090
 Identities = 14/51 (27%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +V +++D   L +  +    L    V  ++ Q+  A+  +H+HN IH D+K
Sbjct: 22  LVFEFVDHTVLDDLERYPNGLDENTVRKVMWQVLRAIEFIHRHNIIHRDVK 72


>SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1378

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++EI V +  N HPN +  Y +   +  ++ +VM+Y+    L + +  +  +    ++ +
Sbjct: 265 INEILVMR-ENKHPNIVN-YVDSYLVGEELWVVMEYLAGGSLTDVVT-ETCMDEGQIAAV 321

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            R+  +AL  LH +  IH DIK
Sbjct: 322 CRECLQALEFLHSNGVIHRDIK 343


>SB_11460| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 323

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 13/51 (25%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I+ D  +  DL E ++  G L+ +    + RQ+   ++ +H  + +H D+K
Sbjct: 127 IITDLAENGDLLEYIRTHGALTEKASRRLFRQITAGVHYIHSQDIVHRDLK 177


>SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27)
          Length = 592

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = -3

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           S + V  ++RQ+ E +  LHK N++H DIK
Sbjct: 250 SEKEVVYLLRQILEGIRHLHKQNYVHLDIK 279


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 16/58 (27%), Positives = 32/58 (55%)
 Frame = +3

Query: 519  AEAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEVSRYYNAVVKMKR 692
            AE +I ++   ++ V ++ +V L+  +F ND+ DN AY  V +  +  Y++     +R
Sbjct: 1093 AEIEIEEEDSSEHEVYMDENVVLHAARFVNDIIDN-AYDIVKEEMIHDYFHPSSNRRR 1149


>SB_17930| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 286

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E  V +  ++HP  + ++      +    V++Y+   DL   +Q +  L          +
Sbjct: 73  EKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAE 132

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +C ALN LH+   I+ D+K
Sbjct: 133 ICCALNFLHEKGVIYRDLK 151


>SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37)
          Length = 256

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 17/65 (26%), Positives = 32/65 (49%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++        +VM+++   DL   L  K   + +     I +   A++ +H+  FI
Sbjct: 111 VKMYYSFQDDYYLFLVMEFLPGGDLMTLLMKKDTFTEEETRFYIAEALLAIDSIHQLGFI 170

Query: 16  HNDIK 2
           H DIK
Sbjct: 171 HRDIK 175


>SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1142

 Score = 32.3 bits (70), Expect = 0.48
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -3

Query: 112 LQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L+++  L+   +  + RQL E L  LH H  IH D+K
Sbjct: 320 LELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLK 356


>SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37)
          Length = 1655

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
            +P+F KI   H   ++ ++  D++    L   L+ K GELS   V  +   L +AL +LH
Sbjct: 1512 NPSFPKI--KH---DSLLLCFDFVSNTTLDAFLREKEGELSLDCVCAVAIDLSDALIELH 1566

Query: 31   KHNFIHNDI 5
             H  +HN I
Sbjct: 1567 NHGVVHNAI 1575


>SB_26967| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 428

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 12/81 (14%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFE------------TLQIKGELSHQLVSNII 65
           HP+ IK+Y       +  +VM+Y+   +LFE            T   K +L  +      
Sbjct: 77  HPHIIKLYQVISTPTDIFMVMEYVSGGELFEYILKHGKVQCDKTSHFKVQLEEKDARRFF 136

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+   ++  H+H  +H D+K
Sbjct: 137 QQIISGVDYCHRHMVVHRDLK 157


>SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20)
          Length = 956

 Score = 31.9 bits (69), Expect = 0.63
 Identities = 10/34 (29%), Positives = 21/34 (61%)
 Frame = -3

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +G L   +++ ++R++ + L   HK+  IH D+K
Sbjct: 797 EGVLEEDIIATVLREVLKGLEYFHKNGLIHRDVK 830


>SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14)
          Length = 322

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N+  ++M+Y    DL   +  K  L  ++    +RQL  AL  +  ++  H D+K
Sbjct: 128 NHIFLIMEYCGGGDLSRFIHSKRALPERMARKFLRQLACALQYMRSYDVAHMDLK 182


>SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 890

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = -3

Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           Q KG  SH  +  +  Q+ +++  +H+  F+H DIK
Sbjct: 15  QPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIK 50


>SB_28695| Best HMM Match : Ras (HMM E-Value=0)
          Length = 1058

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I M+++    + + L+  G     +     RQ+ + ++ LH +N IH DIK
Sbjct: 256 IFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIK 306


>SB_41851| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 967

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 18/81 (22%), Positives = 38/81 (46%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           +DEI +   +  HP+ IK         +  I ++++    +   L   G     ++   +
Sbjct: 663 MDEIAILARLK-HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYL 721

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ + ++ LH++  +H DIK
Sbjct: 722 RQILQGVSYLHENQVVHRDIK 742


>SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05)
          Length = 228

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = -3

Query: 118 ETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + L+ KG L  + V   + Q+ + L+ LH  N IH D+K
Sbjct: 18  QLLRDKGPLVEETVRQYVWQILKGLSFLHGVNIIHRDLK 56


>SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 641

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVH-QLMNDHPNFIKIYFNHGFINNQVIVMDYID-CP--DLFETLQIKGELSHQLVSN 71
           EI++H ++M+ H     I   HG+  ++  +   ++ CP   L E  + +  L+   V  
Sbjct: 88  EIEIHGKVMHKH-----IVGFHGYFEDRDYIYILLELCPRRSLMELHKRRRALTEPEVRY 142

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
            ++Q+ +A   LHK   IH D+K
Sbjct: 143 FMKQIIDACIYLHKSRIIHRDLK 165


>SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 604

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 4/66 (6%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE----LSHQLVSNIIRQLCEALN 41
           H N I++Y      +   +VM+Y    DL + +  +      +   L  N  RQL E + 
Sbjct: 110 HHNVIQLYETFHTCHKIFLVMEYAAKGDLLDYINSRCRRCVGIGEDLAKNFFRQLTEGIM 169

Query: 40  DLHKHN 23
             HK N
Sbjct: 170 HCHKRN 175


>SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26)
          Length = 187

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 15/51 (29%), Positives = 24/51 (47%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y++  D    L+  G L   L      +   A+  LH +  +H DIK
Sbjct: 34  MVMEYVEGGDCASLLKNIGALPADLARMYFAETVLAVEYLHSYGIVHRDIK 84


>SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -3

Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + KG L   L       + +A+  +H + FIHNDIK
Sbjct: 10  EYKGPLPEDLYIPFTTDILKAVEFMHGNGFIHNDIK 45


>SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 478

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = -3

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDI 5
           ++ ++RQ+  A+  L  HNFIH D+
Sbjct: 309 MTEMVRQVAAAMKYLESHNFIHRDL 333


>SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = -3

Query: 124 LFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + E ++  G L+  L     RQ+ E +  LH +  +H DIK
Sbjct: 3   IHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 43


>SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -3

Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + KG L   L       + +A+  +H + FIHNDIK
Sbjct: 10  EYKGPLPEDLYIPFTTDILKAVEFMHGNGFIHNDIK 45


>SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 622

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = -3

Query: 148 MDYID-CPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           MD  D C ++   +      S  + S+ +RQ+ EA++  H++  IH D+K
Sbjct: 1   MDGADLCFEIVNRVNAGFVYSEAVASHYMRQVLEAVSFCHENGIIHRDLK 50


>SB_35776| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 558

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNI-IRQLCEALNDLHKHNFIHNDIK 2
           +VMDY    DL   L    ++  + ++   + ++  A++ LH   F+H D+K
Sbjct: 156 LVMDYHPGGDLLSLLSKYDDIFEEDMARFYLAEIVMAIHSLHTMGFVHRDVK 207


>SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1822

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 13/51 (25%), Positives = 25/51 (49%)
 Frame = -3

Query: 154  IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            I M+Y +   L + + +    +   V  ++R++ E L  +H    IH D+K
Sbjct: 1051 IQMEYCEKSTLRDVIDMGLHTNTDRVWRLLREIVEGLAHIHSQGIIHRDLK 1101


>SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10)
          Length = 251

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = -1

Query: 369 NCKNVKTRYKIINGRFGKISILSHKPTSKLYLQKTIS 259
           N  + KT   I  G FG++ ++ H  T K+Y  K +S
Sbjct: 68  NNDDFKTLKVIGRGAFGEVQLVRHTHTKKVYAMKLLS 104


>SB_46109| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 386

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
 Frame = -1

Query: 423 GHHHRHKCTLQ--TLVQFYENCKNVKTRYKIINGRFGKISILSHKPTSKLYLQKTISAPI 250
           GH H+    L+    +Q++++CK  KTR  II  +  K S   H+  S L L +  S  I
Sbjct: 259 GHRHQGYGHLRFTKAMQYFKDCKISKTRL-IIQNQERKTSCFKHRFRSNLLLLRGFSTFI 317

Query: 249 L 247
           +
Sbjct: 318 I 318


>SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 463

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = -3

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
           S ++  +C AL+ LHK    H D+K
Sbjct: 196 SLVVNDICSALDFLHKQGIAHRDLK 220


>SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 13/46 (28%), Positives = 27/46 (58%)
 Frame = -3

Query: 139 IDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +D  D+ + +  K +++ +  + +IR +  AL  LH+ N +H DI+
Sbjct: 126 LDGEDVLKFMSSKTKVTEEDAALVIRGILNALCYLHELNIVHLDIR 171


>SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07)
          Length = 165

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           DH N +K+       N++ I  V +Y+D  DL   ++    L       I+ QL +A   
Sbjct: 26  DHENVVKLMNVIKADNDKDIYLVFEYMDT-DLHNVIKRGNILKDIHKRYIMYQLLKATKF 84

Query: 37  LHKHNFIHNDIK 2
           +H  N IH D+K
Sbjct: 85  IHSGNVIHRDLK 96


>SB_4038| Best HMM Match : v110 (HMM E-Value=5.5)
          Length = 228

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = -3

Query: 469 Y*INKIVQIHIYDSSWPPPPPQMYAANAGTILRKLQKRQNS 347
           Y   +IV+I +YD + P PP  +  AN   IL    +R  +
Sbjct: 133 YSFRRIVKIRLYDCTLPWPPQFVGEANGRNILSDWHRRSGA 173


>SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1831

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = -1

Query: 402  CTLQTLVQFYENCKNVKTRYKIINGRFGKISILSHKPTSK 283
            C L  L  + +    +   YKI++G   KIS  S  PT+K
Sbjct: 1062 CDLSCLTLYPDGTYTIAPNYKIVDGTCVKISPTSITPTTK 1101


>SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 456

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 18/79 (22%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V  L   HP    ++      ++   VM+Y++  DL   +Q +G+   +       +
Sbjct: 335 ERRVLALATRHPFLTHLHSAFQSADHLFFVMEYLNGGDLMFHIQNQGKFDEKRSRFYAAE 394

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LH+   I+ D+K
Sbjct: 395 IVCGLQFLHELGIIYRDLK 413


>SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 272

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = -1

Query: 441 IFTIRHGHHHRHKCTLQTLVQFYENCKNVKTRYKIINGRF 322
           I  IRH HHH  K +   +V  Y+N +N  +    I  R+
Sbjct: 38  IIKIRH-HHHLSKSSKSVIVIIYQNYQNPSSSSSFIKIRY 76


>SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19)
          Length = 284

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 11/42 (26%), Positives = 21/42 (50%)
 Frame = -3

Query: 127 DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +LFE ++ K   + +      +++ +AL   H  N  H D+K
Sbjct: 5   ELFEQIRKKRRFTEKEAMKFTKEIAQALYHCHSFNVAHRDLK 46


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,211,757
Number of Sequences: 59808
Number of extensions: 448293
Number of successful extensions: 1548
Number of sequences better than 10.0: 67
Number of HSP's better than 10.0 without gapping: 1389
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1539
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2251677692
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -