SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07)                 30   1.7  
SB_27581| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.0  
SB_14190| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.3  
SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14)                  29   5.3  
SB_14192| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.3  
SB_51659| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.2  
SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.2  
SB_34084| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.2  

>SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07)
          Length = 493

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 5/57 (8%)
 Frame = +1

Query: 115 LCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNE-----NECCT*P 270
           +C S   +  +PM P   +  W+  RRA    TRP  NY+ P        NE CT P
Sbjct: 40  VCHSRHRSTIRPMVPGGLLSMWLLERRAPTHKTRP--NYTSPTTNAARIVNEGCTKP 94


>SB_27581| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 292

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +2

Query: 437 WRTQHGRFKDHHRYGHQVHWQTGRDEYILIADRMYVDL 550
           +R + GRF    +Y   VH  T    + LIA ++YV L
Sbjct: 115 FRLRMGRFSPEIKYVQGVHQNTAEQNFSLIAGKIYVCL 152


>SB_14190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 261

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 9/35 (25%), Positives = 17/35 (48%)
 Frame = +2

Query: 449 HGRFKDHHRYGHQVHWQTGRDEYILIADRMYVDLI 553
           H ++  H   G + HW+ G D Y +      ++L+
Sbjct: 187 HNKYNRHDNVGFESHWRKGEDGYAIHVGGALLELV 221


>SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14)
          Length = 1774

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 3/68 (4%)
 Frame = +2

Query: 545 DLIYSEFRAIILPQSAYIIKGDYAESDSESGQSVDVCNELQYPWNLITANSFNVSTDES- 721
           +L+Y+E + +I  +   +++ +Y   D  +G  V  C E   P N    NS+N  T+++ 
Sbjct: 150 ELLYAEQKVVIKCED--MLRWEYCGPDWRTGL-VPTCTEDLIPTNDTRINSYNSQTEQTC 206

Query: 722 --RQSQYI 739
             R+SQ I
Sbjct: 207 VLRESQNI 214


>SB_14192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 261

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 9/35 (25%), Positives = 17/35 (48%)
 Frame = +2

Query: 449 HGRFKDHHRYGHQVHWQTGRDEYILIADRMYVDLI 553
           H ++  H   G + HW+ G D Y +      ++L+
Sbjct: 187 HNKYNRHDNVGFESHWKKGEDGYAIHVGGALLELV 221


>SB_51659| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 194

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 18/66 (27%), Positives = 26/66 (39%)
 Frame = +1

Query: 178 WIHPRRANCKVTRPRNNYSDPDNENECCT*PC*TACF*TSTQNCIIGTCCATIKPRREKQ 357
           W   RR NC VTRP  N +           P  +  +    QNC+      T+  R  + 
Sbjct: 37  WYGRRRYNCAVTRPSTNLALLSLTTVIGREPVLSQWYGRRRQNCVRNRFDITVLTRYYQA 96

Query: 358 FSTPTT 375
            + P+T
Sbjct: 97  VTRPST 102


>SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2870

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%)
 Frame = +1

Query: 238  PDNENECCT*PC*TACF*TSTQNCIIGTCCATI-KPRREKQFST---PTTCTSAC 390
            P+   +CCT  C   C  ++ +      CC TI +P +E   +T   P+ C  +C
Sbjct: 1447 PECPVKCCTGECPAGCLPSNCKPDCPSKCCLTILEPLQEGPNATAYCPSDCFESC 1501


>SB_34084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 261

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +3

Query: 426 VDEAGEHNMGVLKIIIDTVIKYIGKLAE 509
           VD+ GEHNMGV K+  D +   + K+AE
Sbjct: 33  VDKVGEHNMGVDKVSEDDI--GVDKVAE 58


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,726,077
Number of Sequences: 59808
Number of extensions: 408139
Number of successful extensions: 989
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 904
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 988
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2010148439
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -