SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120041.Seq
         (827 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33738| Best HMM Match : Pox_A32 (HMM E-Value=0.33)                  30   2.0  
SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.6  

>SB_33738| Best HMM Match : Pox_A32 (HMM E-Value=0.33)
          Length = 437

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = -3

Query: 576 RKNAIRRATHANKTCSGLWCLECSCSCVNAVYNALRAACET 454
           ++NA+  A  AN T  GL  L  SC+  +  +     ACET
Sbjct: 101 KENALNAAHGANHTRQGLATLRSSCTPTSRAFALQSTACET 141


>SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1203

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
 Frame = +3

Query: 153 DAYHD-DGWFICNSHLIKRFKMSKMVL-PIFDEDDNNSK*RSLGI*LEIKKE 302
           DA  D  GW++    L+K+F+ S+M    +  +DD     + + + L++ KE
Sbjct: 186 DASSDFKGWYLLKKQLLKKFENSRMATKKLVSDDDGTPYRKKMKLSLKVNKE 237


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,366,131
Number of Sequences: 59808
Number of extensions: 538893
Number of successful extensions: 1466
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1369
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1463
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2323539746
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -