SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_21206| Best HMM Match : PaREP8 (HMM E-Value=2.4)                    40   0.002
SB_47506| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.25 
SB_30263| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.33 
SB_15799| Best HMM Match : PH (HMM E-Value=0.76)                       31   0.76 
SB_55028| Best HMM Match : Dynamitin (HMM E-Value=0.66)                31   0.76 
SB_30188| Best HMM Match : fn1 (HMM E-Value=0.48)                      30   1.8  
SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     30   2.3  
SB_22160| Best HMM Match : Arc (HMM E-Value=7.5)                       30   2.3  
SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24)                   29   3.1  
SB_21242| Best HMM Match : Prog_receptor (HMM E-Value=0.79)            29   4.1  
SB_46289| Best HMM Match : DUF1690 (HMM E-Value=0.32)                  29   4.1  
SB_3185| Best HMM Match : Sec63 (HMM E-Value=0)                        29   5.4  
SB_17656| Best HMM Match : TIR (HMM E-Value=1.3)                       28   7.1  
SB_806| Best HMM Match : No HMM Matches (HMM E-Value=.)                28   7.1  
SB_55146| Best HMM Match : Synaptobrevin (HMM E-Value=1.4)             28   7.1  
SB_22442| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.4  

>SB_21206| Best HMM Match : PaREP8 (HMM E-Value=2.4)
          Length = 589

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +2

Query: 248 EQHLRDRIKSKV-DEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKI 424
           E+++ D IK  V DE+  Q ++  S+ ID    N+Q+     + + C  G+++K+   K 
Sbjct: 49  EKYISDAIKDDVSDEELQQHKKNASEHIDPESQNLQFKCQSEHEILCMWGNIVKNPRLKC 108

Query: 425 LK--SHDYT 445
           +K  SHD++
Sbjct: 109 VKFDSHDFS 117


>SB_47506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 391

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 21/92 (22%), Positives = 52/92 (56%), Gaps = 4/92 (4%)
 Frame = +2

Query: 245 QEQHLRDRIKSKVDEQFDQLEREYSDK----IDGFHDNIQYFKDEHYSVSCQNGSVLKSK 412
           QE++L  + KS++++Q  QL+RE+S++    +D  +  +++ +DE+ + S      +++ 
Sbjct: 29  QEENLVSKSKSQLEQQRLQLQREHSNEMEKMLDKTNSRLKHMEDEYATRSATAQETVRTL 88

Query: 413 FAKILKSHDYTDKKSIETYEKYCLPQLVDKHN 508
             +I K  +   +  + + +K  +  + +KHN
Sbjct: 89  EGEIKKLKEENLRMRLSSEKK--IGSVSEKHN 118


>SB_30263| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 976

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 580 YNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDGKQFEEFVQKLI 723
           ++ +    +V F H I   G+Y Y  L   D  + + +QF E V+KL+
Sbjct: 644 HSAVAETAVVGFPHPIKGEGIYAYATLK--DDAQIEPEQFREEVKKLV 689


>SB_15799| Best HMM Match : PH (HMM E-Value=0.76)
          Length = 836

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +2

Query: 371 YSVSCQNGSVLKSKFAKILKSHDYTDKKSIET-YEKYCLPQLVDKHNTATWRYAC*SRDL 547
           YS +     VLKS F K+  +H  +   +I+  Y+ YC      KH ++  R+   +  L
Sbjct: 4   YSENTSKDIVLKSGFRKLENTHSSSGDVTIKKFYDSYCTCS-AKKHRSSFVRHDR-THSL 61

Query: 548 RTAATKCYL 574
            T  TKC L
Sbjct: 62  STVQTKCLL 70


>SB_55028| Best HMM Match : Dynamitin (HMM E-Value=0.66)
          Length = 1709

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 13/44 (29%), Positives = 24/44 (54%)
 Frame = +2

Query: 362 DEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQL 493
           D H+S++CQ+ + + +K       HD+    S+ T  ++C P L
Sbjct: 9   DRHHSLTCQSNAEVITKSYPGPSIHDFVTNTSLATIMQHCAPLL 52


>SB_30188| Best HMM Match : fn1 (HMM E-Value=0.48)
          Length = 334

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 260 RDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQN 391
           R+ +K KV +    LEREY D  + F+D +   +D H ++  Q+
Sbjct: 234 RESLKLKVRDSTLWLEREYMDSFERFNDKLPAKEDFHSTMYDQH 277


>SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 1741

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 1/98 (1%)
 Frame = +2

Query: 191  KTRSHDV*HFGSYTKRYAQEQHLR-DRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDE 367
            K RS ++    S  K Y  E+ L+  R         D L+R++       HD I      
Sbjct: 1436 KVRSQEMFQCESCKKVYNTERGLKYHRALQHWKPSKDNLQRKFIGSKLQSHDRINV--KP 1493

Query: 368  HYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKYC 481
            H  + C+ G   +S+    +K+H     KS     KYC
Sbjct: 1494 HQCIVCRKGFTARSRLLHHVKAHHNMKTKSNIFTCKYC 1531


>SB_22160| Best HMM Match : Arc (HMM E-Value=7.5)
          Length = 246

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +1

Query: 598 KVIVPFAHEINDTGLYEYDVLA--YVDSVEFDGKQFEEFV 711
           K+ + F+H+    GL  ++++   Y + VEF+ KQFEEFV
Sbjct: 184 KMAIVFSHQF---GLRGFNIIMDEYENRVEFEYKQFEEFV 220


>SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24)
          Length = 208

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -1

Query: 196 GFVNCVFIILLMYTNSLVCSST*QSRITVWD 104
           G VNCV+ I       L+CS +  S + VWD
Sbjct: 99  GHVNCVYQIAWSADCRLICSGSADSTLKVWD 129


>SB_21242| Best HMM Match : Prog_receptor (HMM E-Value=0.79)
          Length = 1091

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +2

Query: 266 RIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEH 370
           R+KS ++   D L+ ++S  +D  HD I+  K+E+
Sbjct: 790 RVKS-LENSLDFLQAQHSQVLDNLHDEIERLKEEN 823


>SB_46289| Best HMM Match : DUF1690 (HMM E-Value=0.32)
          Length = 947

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 24/100 (24%), Positives = 46/100 (46%)
 Frame = +2

Query: 176  EHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQY 355
            EH + K  SH +   G  ++    E+ + D  +SKV  +   +E+E ++K+D  H +I  
Sbjct: 731  EHGL-KAESHMLIDDGFLSRVQHVEKRVIDA-QSKVSSELSAMEQEMAEKLDALHVDINT 788

Query: 356  FKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEK 475
             K    +++   G  +  +   +L      + KS E  +K
Sbjct: 789  AK----TLAGSMGHAITDRVNGVLNRAKQLELKSKERLQK 824


>SB_3185| Best HMM Match : Sec63 (HMM E-Value=0)
          Length = 2590

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +2

Query: 296 DQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTD--KKSIETY 469
           D+  RE+S+++    DN+  FK+E  S  C N  + +S    I K  + T+  +K ++  
Sbjct: 428 DKFRREFSERVGEVIDNLSEFKEESTSF-CSN--ISQSIGMLISKKSEETNDLQKQMDRM 484

Query: 470 EKYCLPQLVDKHNTA 514
               L ++V+  N A
Sbjct: 485 ANDLLERMVEISNNA 499


>SB_17656| Best HMM Match : TIR (HMM E-Value=1.3)
          Length = 719

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 511 CYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVP 612
           C V V +L PGF+  S     +E+     K I+P
Sbjct: 274 CSVFVPILTPGFQESSKHQQEYEFARANQKQIIP 307


>SB_806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 228

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 22/104 (21%), Positives = 43/104 (41%)
 Frame = +2

Query: 194 TRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHY 373
           T ++ V  +  + + +  ++H+R  I  K   +    ++     I   H  I  + D+H 
Sbjct: 29  TNTYGVHIYDKHMRVHIYDKHMRVHIYDK-HIRIHIYDKHIRVHIYDKHIRIHIY-DKHI 86

Query: 374 SVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLVDKH 505
            V   N  +    + K ++ H Y     I  Y+K+    + DKH
Sbjct: 87  RVHIYNKHIRVHIYDKHIRVHIYDKHIRIHIYDKHIRVHIYDKH 130


>SB_55146| Best HMM Match : Synaptobrevin (HMM E-Value=1.4)
          Length = 810

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 10/33 (30%), Positives = 18/33 (54%)
 Frame = +2

Query: 251 QHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNI 349
           QH  D +   +   + Q+ R+++D   G+H NI
Sbjct: 682 QHKNDDLAHYLSTDYKQVNRDFADNSSGYHFNI 714


>SB_22442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 233

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 15/68 (22%), Positives = 31/68 (45%)
 Frame = -3

Query: 260 ANVVLARNASYRTRNVKHHENGFCQLRVHNLVNVHQLSGLFVHMTISNNRLGHVDFYRKN 81
           ++V++ +         K  E+    L+  N  +V    G + H+T+  N+  H+   +  
Sbjct: 143 SHVIIIKGRYSHVTMSKGRESHVTMLKGRNS-HVTMRKGRYSHVTMMKNKDNHLTMRKGR 201

Query: 80  YTHFAMVK 57
           Y+H  M+K
Sbjct: 202 YSHVTMMK 209


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,567,858
Number of Sequences: 59808
Number of extensions: 473823
Number of successful extensions: 1478
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1302
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1465
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2058295707
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -