SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_51040| Best HMM Match : Kinesin (HMM E-Value=5.89947e-43)           31   1.4  
SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.5  
SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_33738| Best HMM Match : Pox_A32 (HMM E-Value=0.33)                  28   9.5  
SB_21375| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.5  

>SB_51040| Best HMM Match : Kinesin (HMM E-Value=5.89947e-43)
          Length = 197

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
 Frame = +2

Query: 221 AHFRRRRQSIQMTIAR-HLVGNKERGIKRILIPSATNYQEVFN-LNSMMQAEQLIFHLIY 394
           AHF   R S+   + + +L GN +  +   + PSA NY+E  + L    +A++++ H + 
Sbjct: 131 AHFVPYRDSVLTWLLKDNLGGNSKTVMVATISPSADNYEETLSTLRYADRAKKIVNHAVV 190

Query: 395 NNE 403
           N +
Sbjct: 191 NED 193


>SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1203

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 144 DAYHD-DGWFICNSHLIKRFKMSKMVLP--IFDEDDNQFK*RSLGI*LEIKKE 293
           DA  D  GW++    L+K+F+ S+M     + D+D   ++ + + + L++ KE
Sbjct: 186 DASSDFKGWYLLKKQLLKKFENSRMATKKLVSDDDGTPYR-KKMKLSLKVNKE 237


>SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3176

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +3

Query: 390  YITT---KRRLTLYATI*NIPKFHKRHATRYTQRLRNYKKHSSTTNPNTFCSRVSRDELR 560
            YI+T   +R+L   A   N+P+FH RH      R RN +  SS    N  CS  +   L 
Sbjct: 2174 YISTAMPERQLHQVAVEENLPRFHHRHPGN-LNRERNLEVVSSRVEQN-ICSTSANIPLH 2231

Query: 561  FFDVTNA 581
               VT++
Sbjct: 2232 SSSVTSS 2238


>SB_33738| Best HMM Match : Pox_A32 (HMM E-Value=0.33)
          Length = 437

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = -1

Query: 567 RKNAIRRATHANKTCSGLWC*NASCSCVNAVYNALRAACET 445
           ++NA+  A  AN T  GL    +SC+  +  +     ACET
Sbjct: 101 KENALNAAHGANHTRQGLATLRSSCTPTSRAFALQSTACET 141


>SB_21375| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 90

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 13/47 (27%), Positives = 23/47 (48%)
 Frame = +3

Query: 450 HKRHATRYTQRLRNYKKHSSTTNPNTFCSRVSRDELRFFDVTNARTH 590
           + RH TRYT+ + +Y +H   T      +R +R  +R+ +      H
Sbjct: 21  YMRHVTRYTRHVTHYTRH--VTRYTGHVTRYTRHAIRYTNHVTCYKH 65


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,597,896
Number of Sequences: 59808
Number of extensions: 495775
Number of successful extensions: 1325
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1223
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1319
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2082369341
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -