SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120036.Seq
         (735 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.97 
SB_42336| Best HMM Match : Sushi (HMM E-Value=1.5e-08)                 30   2.2  
SB_8770| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   2.2  
SB_29188| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.0  
SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.2  
SB_52476| Best HMM Match : FLYWCH (HMM E-Value=5.5)                    28   6.8  
SB_2321| Best HMM Match : DUF1461 (HMM E-Value=2.1)                    28   9.0  

>SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2149

 Score = 31.1 bits (67), Expect = 0.97
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +1

Query: 505  QLGNVLYEPCTYDMQKLGSFILVSLSARDKLICKSYRQ 618
            Q   +  +P  YD  +L + I+VS S R++L+CK   Q
Sbjct: 1389 QANGLSNQPSRYDQGQLSTRIVVSKSPREELVCKDSSQ 1426


>SB_42336| Best HMM Match : Sushi (HMM E-Value=1.5e-08)
          Length = 303

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 298 DLKKSTKTVPKVFYTARNVISIVN*RAETTGSKV---KRGGGYFSFHCWFS 441
           D KK  KT   ++    NV S ++    TT S     + GG Y   HC FS
Sbjct: 74  DCKKGFKTTSSIYKCQANVCSALSTVTGTTVSPAGCTQTGGAYAGIHCVFS 124


>SB_8770| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1303

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +3

Query: 201  YRH-KCLHTVSMSCNIQDVSIDSRKRR*NW**ARSKKKHENSSESVLHSTQCN 356
            Y H KC HT S S   Q V++ S K   +       + H  +S S  H T+C+
Sbjct: 1109 YHHTKCHHTTSHSTITQPVTVPSHKMPSH----NQSQYHHTTSHSAYHHTKCH 1157


>SB_29188| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 468

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 12/43 (27%), Positives = 26/43 (60%)
 Frame = +2

Query: 413 GTFRFIAGSQKSQERVLIISVYVGITI*VHFNSGMFFMNPVRM 541
           G +R ++G  KSQ   L+I+ +VG+ + + F + +  +N  ++
Sbjct: 155 GYYRMVSGCNKSQTTPLVITQFVGVFLVLAFAAVVVILNKKKL 197


>SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1967

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 20/56 (35%), Positives = 28/56 (50%)
 Frame = +1

Query: 442  KITRTCINNFRLRRYNDLSPLQLGNVLYEPCTYDMQKLGSFILVSLSARDKLICKS 609
            KI R  +NNFRLR  +  S + +  + +          GS+ILVS   RD+   KS
Sbjct: 1575 KILRALVNNFRLRNCSLASVIHINGIAF----------GSYILVSAFRRDQKEKKS 1620


>SB_52476| Best HMM Match : FLYWCH (HMM E-Value=5.5)
          Length = 151

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 6/86 (6%)
 Frame = +1

Query: 373 RAETTGSKVKRGGGYFSFHCWFSKITRTCINNFRLRRYNDLSPLQLGNVL------YEPC 534
           RA +T  +       F+ + WFS      I     R   D +P+Q G+++      Y   
Sbjct: 16  RALSTKDRTNTINNSFTGNSWFSH--NHAIFRIFSRIATDGTPVQYGDIVGLLYPSYSSY 73

Query: 535 TYDMQKLGSFILVSLSARDKLICKSY 612
           T+     G + L+SLSAR   +C+S+
Sbjct: 74  TWLYYSGGRYGLMSLSARRDSLCESF 99


>SB_2321| Best HMM Match : DUF1461 (HMM E-Value=2.1)
          Length = 340

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 24/100 (24%), Positives = 43/100 (43%)
 Frame = +1

Query: 397 VKRGGGYFSFHCWFSKITRTCINNFRLRRYNDLSPLQLGNVLYEPCTYDMQKLGSFILVS 576
           ++RG G +   CW   ++  C+ + +L             VL  P T ++  L   + ++
Sbjct: 167 LRRGSGSYGLLCWQCSMSIDCVKDEQL------------EVLMAPSTTNLALL--IVAIT 212

Query: 577 LSARDKLICKSYRQNYVNFNGCHKAFSFSLLFVRLRIRFY 696
           +S   K I   +R  +  F+ C    S  L+  RL +R Y
Sbjct: 213 ISTLWKAISSFFR--WSRFDECEFFLSRDLIIRRLLVRCY 250


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,953,060
Number of Sequences: 59808
Number of extensions: 400593
Number of successful extensions: 837
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 794
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 837
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1974037988
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -