SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06)             33   0.25 
SB_2813| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.76 
SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07)                     31   1.3  
SB_25320| Best HMM Match : 7tm_1 (HMM E-Value=3.29305e-43)             29   3.0  
SB_33958| Best HMM Match : MAM (HMM E-Value=1.1e-32)                   29   4.0  
SB_12855| Best HMM Match : TPR_2 (HMM E-Value=2.3e-12)                 29   4.0  
SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.0  
SB_47025| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.3  
SB_1442| Best HMM Match : SRCR (HMM E-Value=0)                         29   5.3  
SB_28947| Best HMM Match : Sugar_tr (HMM E-Value=2.1e-06)              28   7.0  
SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0)                 28   9.3  
SB_24969| Best HMM Match : DUF645 (HMM E-Value=1.8)                    28   9.3  
SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   9.3  
SB_43994| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.3  
SB_43634| Best HMM Match : Sushi (HMM E-Value=1.2e-16)                 28   9.3  
SB_27552| Best HMM Match : Phage_integrase (HMM E-Value=0.31)          28   9.3  
SB_26103| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.3  
SB_16669| Best HMM Match : Phage_integrase (HMM E-Value=0.28)          28   9.3  
SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   9.3  

>SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06)
          Length = 1425

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = -3

Query: 306 PRLSVVLSKHSIISLSSVTN*RLPKSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYH 127
           PR  VV     +  + S  +  L   + +L+        RLH  W C ++  S  A++YH
Sbjct: 761 PRTQVVTKLIELADVLSDKHGNLVSFMAVLEGLALPQVTRLHHTWSCLHHQYSSSAIMYH 820

Query: 126 KTL 118
            TL
Sbjct: 821 STL 823


>SB_2813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1362

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -3

Query: 177  AWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASE 79
            AW  YN + ++W VVY KT   + R  L    E
Sbjct: 1207 AWKIYNETKNKWYVVYTKTAEQKERWRLAFTEE 1239


>SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07)
          Length = 1447

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 218 SSFKLFGKRQFVTDDNDIMECLLKTTDNLGEAVSSAYYSESLELPVAENHR 370
           SS KL  K   +TD+N+ ++  LKTTD  G         ESL + +AE+ R
Sbjct: 606 SSQKLQSKINTLTDENNSLKVRLKTTD--GTIERQIQQVESLTVQLAESER 654


>SB_25320| Best HMM Match : 7tm_1 (HMM E-Value=3.29305e-43)
          Length = 391

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -1

Query: 515 RLHLFLLNWPTTLCESSKYSSSFRLVPAADGW 420
           R+   +L W + +C    Y  +FRLVP  DG+
Sbjct: 146 RIFTLVLTWLSAMCFYVPYFITFRLVPFRDGY 177


>SB_33958| Best HMM Match : MAM (HMM E-Value=1.1e-32)
          Length = 1052

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +3

Query: 612 THYFTNDFAPYLMRFDDNDYNSNRFSDHMSETGYYMFVVKKSEVKP 749
           T+   NDF  YL   +     +  F+DH + TGYY FV       P
Sbjct: 197 TNEIGNDFDWYLGIGETFSRFTGPFADHTTGTGYYAFVESSKPNNP 242


>SB_12855| Best HMM Match : TPR_2 (HMM E-Value=2.3e-12)
          Length = 567

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 17/73 (23%), Positives = 35/73 (47%)
 Frame = +3

Query: 498 QE*MKPKYKKSTIQSCATLEQTINHNTNICTVASTQEITHYFTNDFAPYLMRFDDNDYNS 677
           +E MK  ++K    +    ++    +T +  + + Q    Y  ND+  Y   +DDNDY++
Sbjct: 78  REKMKKTFQKLLTTNLGVDDEDKYVSTPVRYMQNAQYHKDYNDNDYDDY--NYDDNDYDN 135

Query: 678 NRFSDHMSETGYY 716
           + + D+  +   Y
Sbjct: 136 DDYDDYNYDDNDY 148


>SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1074

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 19/80 (23%), Positives = 38/80 (47%)
 Frame = +3

Query: 510  KPKYKKSTIQSCATLEQTINHNTNICTVASTQEITHYFTNDFAPYLMRFDDNDYNSNRFS 689
            +P+  KST+ +    +QT NHN ++C+ ++  + +   T+     + R D    +   F 
Sbjct: 924  EPRIAKSTVYT----KQTTNHNAHVCSQSTADQTSASITSYTMRKVDRKDIIRKHGLNFH 979

Query: 690  DHMSETGYYMFVVKKSEVKP 749
             +  +T  YM     S+ +P
Sbjct: 980  FYADDTQIYMSFNPLSDKEP 999


>SB_47025| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1010

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -1

Query: 515 RLHLFLLNWP-TTLCESSKYSSSFRLVPAA 429
           RLH+ LL  P + LC  + Y++  RLVPA+
Sbjct: 757 RLHISLLRIPGSLLCPVAAYNNMIRLVPAS 786


>SB_1442| Best HMM Match : SRCR (HMM E-Value=0)
          Length = 2103

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 2/79 (2%)
 Frame = +3

Query: 516  KYKKSTIQSCATLEQTINHNTNICTVASTQEITHY--FTNDFAPYLMRFDDNDYNSNRFS 689
            K   S IQ+   + +++   T  CT  +   +T Y  F ND   YL+   D  YN + FS
Sbjct: 1685 KLTSSAIQNTVFINESV---TLTCTADANPPVTQYKIFRND--AYLVSVLDGVYNISTFS 1739

Query: 690  DHMSETGYYMFVVKKSEVK 746
               ++ G Y  V + ++ K
Sbjct: 1740 --AADNGTYKCVAENNQGK 1756


>SB_28947| Best HMM Match : Sugar_tr (HMM E-Value=2.1e-06)
          Length = 624

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -3

Query: 444 FSSSCRWLVHTNRLLKRFRIISRTG 370
           F  S RWL+  NRL +  +++SR G
Sbjct: 190 FPESARWLIANNRLDEALQVLSRYG 214


>SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0)
          Length = 683

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 15/41 (36%), Positives = 19/41 (46%)
 Frame = +3

Query: 105 DNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAAS 227
           DNG    C  ++  D + +   PTP G   V SD    AAS
Sbjct: 581 DNG----CTTEETMDTMGFIIPPTPTGGHNVTSDKPVMAAS 617


>SB_24969| Best HMM Match : DUF645 (HMM E-Value=1.8)
          Length = 336

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -1

Query: 515 RLHLFLLNWP-TTLCESSKYSSSFRLVPAA 429
           RLH+ LL  P + LC  + Y++  RLVPA+
Sbjct: 281 RLHIPLLRIPGSLLCPVAAYNNMIRLVPAS 310


>SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1017

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 7/68 (10%)
 Frame = +3

Query: 3   DIGGDTIVNNQTTM---TQINFNASY-TSAPTPSRASFD--NGYSEFCDKQQPNDYLNYY 164
           DI GD  + ++      T+      Y   +PTP R   +  + +   CD   P   LN Y
Sbjct: 436 DIFGDGFIGSENLTCHSTEFKVYGDYWVPSPTPYRLPGEKIDIFGVKCDLPDPPTKLNDY 495

Query: 165 NNP-TPDG 185
           NNP TP G
Sbjct: 496 NNPGTPAG 503


>SB_43994| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 403

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -1

Query: 515 RLHLFLLNWP-TTLCESSKYSSSFRLVPAA 429
           RLH+ LL  P + LC  + Y++  RLVPA+
Sbjct: 125 RLHIPLLRIPGSLLCPVAAYNNMIRLVPAS 154


>SB_43634| Best HMM Match : Sushi (HMM E-Value=1.2e-16)
          Length = 986

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 11/81 (13%)
 Frame = +3

Query: 144 NDYLNYYNNPTPDGADTVVSDSETAAASNFLASVNSL-----------LMITI*WNVCSR 290
           ND  +Y      DG    +S+S    +  +  +VN L           L + I   + S 
Sbjct: 557 NDGKDYKQTCRGDGGSPFISESYDRKSRGYRWAVNGLKRTHQHAYSSFLTVAILSIMVSI 616

Query: 291 PLIISEKQLVLLIIRNPLSCL 353
             II+   L+++II+NPL CL
Sbjct: 617 TAIIANSFLLIVIIKNPLHCL 637


>SB_27552| Best HMM Match : Phage_integrase (HMM E-Value=0.31)
          Length = 270

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -1

Query: 515 RLHLFLLNWP-TTLCESSKYSSSFRLVPAA 429
           RLH+ LL  P + LC  + Y++  RLVPA+
Sbjct: 140 RLHIPLLRIPGSLLCPVAAYNNMIRLVPAS 169


>SB_26103| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1176

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -1

Query: 515 RLHLFLLNWP-TTLCESSKYSSSFRLVPAA 429
           RLH+ LL  P + LC  + Y++  RLVPA+
Sbjct: 684 RLHIPLLRIPGSLLCPVAAYNNMIRLVPAS 713


>SB_16669| Best HMM Match : Phage_integrase (HMM E-Value=0.28)
          Length = 580

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = -1

Query: 515 RLHLFLLNWP-TTLCESSKYSSSFRLVPAA 429
           RLH+ LL  P + LC  + Y++  RLVPA+
Sbjct: 450 RLHIPLLRIPGSLLCPVAAYNNMIRLVPAS 479


>SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 320

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 15/41 (36%), Positives = 19/41 (46%)
 Frame = +3

Query: 105 DNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAAS 227
           DNG    C  ++  D + +   PTP G   V SD    AAS
Sbjct: 218 DNG----CTTEETMDTMGFIIPPTPTGGHNVTSDKPVMAAS 254


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,371,012
Number of Sequences: 59808
Number of extensions: 476434
Number of successful extensions: 1283
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 1184
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1282
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2034222073
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -