SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   1.6  
SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26)                 29   2.1  
SB_32738| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-13)                 29   2.1  
SB_19726| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.1  
SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.8  
SB_45993| Best HMM Match : TEP1_N (HMM E-Value=0.48)                   28   6.4  
SB_55713| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8)                  27   8.5  
SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16)              27   8.5  
SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     27   8.5  

>SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 592

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -1

Query: 306 CGCKYSGSPCFATLSGACAGFGRHAQTSICTCRRRGHVLPVHNLHILNCWRCPW 145
           C C Y G+     +S   A   R A+  +CT  R   +L  +N  + NC RC +
Sbjct: 175 CVCVYGGTG----ISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTY 224


>SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26)
          Length = 333

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = -3

Query: 259 SMCWIWSACSNVDLYLPSTWTRI 191
           SMC +++ C N+ L++P T+  I
Sbjct: 258 SMCTVYNVCKNIPLHIPQTFLHI 280


>SB_32738| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-13)
          Length = 323

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%)
 Frame = -3

Query: 301 VQIQRVALLCHAIWSMCWIWSACS--NVDLYLPST 203
           V +QRV ++C  +W  C I+SA +   V +Y P T
Sbjct: 157 VTVQRVLIICGGMWVSCSIFSAVTLYGVHVYHPVT 191


>SB_19726| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 196

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = -3

Query: 259 SMCWIWSACSNVDLYLPSTWTRI 191
           SMC +++ C N+ L++P T+  I
Sbjct: 121 SMCTVYNVCKNIPLHIPQTFLHI 143


>SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 834

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 32/99 (32%), Positives = 44/99 (44%), Gaps = 3/99 (3%)
 Frame = +2

Query: 248 PAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWL-LEEVIP-QVLC 421
           P +    + K   P   HP TVLI    +I L + + L   I LQ  L L+ +IP QVL 
Sbjct: 316 PLYKSSPLYKSSPPTSTHPSTVLIPLQVLIPLQVLTPLQVLIPLQVLLPLQVLIPLQVLI 375

Query: 422 -TGKYAPAVEMDTNDVIAKIDDLTQKLTVATQILRKQPI 535
                AP   + T  V+  +  LT  L V T +    P+
Sbjct: 376 PLHVLAPLQVVITLQVLTSLQVLT-SLQVLTSLQVLTPL 413


>SB_45993| Best HMM Match : TEP1_N (HMM E-Value=0.48)
          Length = 369

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -1

Query: 327 DLVMSTVCGCKYSGSPCFATLSGACAG 247
           D+VM TV GC+YS S  + +L   C G
Sbjct: 248 DVVMRTVRGCRYSDS-AWMSLCAQCVG 273


>SB_55713| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8)
          Length = 129

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = -1

Query: 324 LVMSTVCGCKYSGSPCFATLSGACAGFGRHAQTSICTCR 208
           +VM  VC C+Y  S C       CA   R    ++C CR
Sbjct: 65  VVMCAVCACRYVRSVCLL----LCAQCLRVVICAVCACR 99



 Score = 27.5 bits (58), Expect = 8.5
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = -1

Query: 324 LVMSTVCGCKYSGSPCFATLSGACAGFGRHAQTSICTCR 208
           +V+  VC C+Y  S C +     CA   R    ++C CR
Sbjct: 90  VVICAVCACRYVRSVCVS----LCAQCLRVVMCAVCACR 124


>SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16)
          Length = 1222

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +3

Query: 183  ERAIRVHVDGKYKSTFEHADQIQHMLQIAWQ 275
            +RAI VHVDG Y    +    +  +L++  Q
Sbjct: 1059 QRAIEVHVDGSYDRAEQQVKDVMDVLKVQEQ 1089


>SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 1449

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 17/52 (32%), Positives = 22/52 (42%)
 Frame = +2

Query: 203 RRRQVQIDV*ACRPNPAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSK 358
           RRR +Q D+   R  P   P   A  G P ++ PH       G   L +K K
Sbjct: 536 RRRHLQNDILNGRKVPEEKPSETATNGPP-FICPHANCGRSFGARHLYLKHK 586


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,644,342
Number of Sequences: 59808
Number of extensions: 446761
Number of successful extensions: 1116
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1046
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1115
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1397989795
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -